KEGG   Paenibacillus polymyxa Sb3-1: RE92_15115Help
Entry
RE92_15115        CDS       T03812                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ppoy  Paenibacillus polymyxa Sb3-1
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ppoy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RE92_15115
  Energy metabolism
   00680 Methane metabolism
    RE92_15115
Enzymes [BR:ppoy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     RE92_15115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3405588..3408380
Genome map
AA seq 930 aa AA seqDB search
MTELTLTANKNQSNNLLRRDVRFLGNILGEVLVHQGGNELLDIVEKIREASKSLRAGYQP
ELYENFKQMVSGLDTDIRHQVIRAFAIYFQLVNIAEQNHRIRRKRDYEHSAGEEVQPGSI
ESSVQELKQGGFSAEDVSNMLNELSLELVMTAHPTEATRRVILDIHKRISEDVMLLDNPM
LTLREREQVRENLLNEVITLWQTDELRDRKPTVLDEVRNGMYYFHETLFHVLPDVYQELE
RCLVKYYPEQKWHIPTYLRFGSWIGGDRDGNPSVTAHVTWETLRMQRKLALREYQHTLKE
LMGYLSFSTSIVRVSDDLLASIEEDRAHITLKKMEVWHNEKEPYRIKLAYMIAKVNNVLD
ESKQGTKERYSSAEELIADLNVIDNSLRHHFADYVADTYIQKMIRQVELFGFHTATLDVR
QHSQEHENAMTEILSKMNIVSDYSKLSEEEKIDLLEQLLNEPRPITSPYLKYSDSTQECL
DVYRTIYLAQEEFGKQSITSYLISMTQGASDLLEVMVLAKEVGLFRIEKDGTVICTLQSV
PLFETIDDLHAAPDIMRRLMNLPVYRQSVAAMDELQEIMLGYSDSNKDGGVVTANWELRV
AMNSITEVVNEYGAKVKFFHGRGGALGRGGMPLNRSILAQPPHTIGGGIKITEQGEVLSS
RYSLKGIAYRSLEQATSALITAAAYHRSGKKEVFEESWEEIIARISEVSLEKYQDLIFRD
PDFFSFFKESTPLPEVGELNIGSRPSKRKNSERFEDLRAIPWVFAWTQSRYLLPAWYAAG
TGLQSYYQNNEDNLKVLQTMFRDSAFFRSLIDTLQMAIAKADLLIAEEYAGMSDNEEARQ
RIFGQISAEFKLTSELILKITGQSEILDDVPVIQESIRLRNPYVDPLSYLQVQLLSELRE
LRNQNGDDAEMLREVLLTINGIAAGLRNTG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcttacgttaaccgctaacaaaaaccaatccaacaatctgctacggcgggac
gttcgttttctaggaaatattcttggtgaggttttggttcatcagggtggcaacgaactt
ttggatatcgtggagaaaatacgtgaggcaagtaaatcgttacgtgccgggtatcagccg
gagttatacgagaatttcaaacaaatggtcagtggactggatacggatattcgtcaccag
gttattcgcgcgtttgcgatttactttcagttggtgaatatcgctgagcagaaccaccgt
attcgtcgtaagcgggattatgagcattccgctggtgaagaggttcaacccggttctatc
gaaagttccgttcaggagcttaaacaaggaggcttctccgctgaggacgttagcaacatg
ttgaatgagctctccttggaactggtcatgactgcacatcctacagaagcaacacgacga
gtaattctggatatccacaaacgtatttccgaagacgtcatgctgctggataatccgatg
cttactttgcgtgagcgagaacaggtacgggaaaatctgcttaatgaagtaattacactg
tggcagacggatgagctgcgtgatcgaaagccaactgtattagatgaagtaagaaatgga
atgtattattttcatgagaccttgtttcatgtattgccggatgtataccaagaactggaa
cgatgtttggtcaaatattatcctgagcaaaaatggcacattccaacttatttgagattt
ggttcttggatcggtggagaccgagacgggaatccatctgttacagctcatgtgacttgg
gaaacgttacgtatgcaacgtaagctggctttgagagagtatcagcacacgctgaaagaa
ctcatgggttacttgagcttcagtaccagcattgtgcgggtttctgatgatttgttggct
tctattgaagaagatcgcgcccacatcacacttaaaaaaatggaagtatggcataacgaa
aaagagccttatcgcatcaaactggcatatatgattgctaaggtgaataacgttttggat
gaaagcaaacagggtaccaaggagcgctacagctccgcggaagaacttattgcagacctg
aatgttattgacaacagcttgcgccatcattttgctgattatgtggcagacacgtatatc
caaaagatgattcgtcaggtagagctattcgggtttcatacggctacgctggatgtgcgt
cagcatagtcaggagcatgaaaatgcgatgactgaaattctttctaaaatgaatattgtg
tcagattacagtaagctgtcagaggaagaaaaaatagatctgctggaacagctgctgaat
gaaccgcgtccgattacttcgccgtatttaaaatatagcgatagcacacaggaatgtctt
gatgtatatcgtacgatttatttggctcaggaggaatttggcaagcagtccattacaagc
tacttgatcagtatgacccaaggggccagtgatttgcttgaggtcatggtattagccaaa
gaggtgggcctgttccgcatcgagaaggatggcactgtcatctgtacgctgcaatccgtt
cctttgttcgaaacgatagatgatttgcacgctgcacctgatattatgagaagattgatg
aacctgcctgtatatcgacaatctgtagccgccatggatgagcttcaggagatcatgctt
ggctactcggatagtaataaggatggcggtgtggttacagcgaactgggaacttcgggtc
gctatgaatagcattacggaagtagtaaacgagtatggcgcaaaagtgaagtttttccac
ggacgtggaggagcgctggggcgtggaggaatgccacttaaccgcagtattctggctcag
cctcctcataccattggtggaggaattaagattacggagcaaggcgaagtgctatcatcc
cgctattcgctcaaggggattgcatatcggagcttggagcaggcgacatcggcgctaatt
acggctgctgcctatcatcgctcgggaaagaaagaagtgttcgaggaaagctgggaggag
attattgcccgtatttccgaggtatcactggagaagtatcaggatttgattttccgagac
ccggatttctttagtttcttcaaagaatctacaccgttgcctgaggtaggcgagctgaat
attggatctcgcccgtccaagcgtaagaatagcgaacgttttgaggacttgcgcgccatt
ccgtgggtttttgcgtggacacaaagtcgttacttgctacccgcttggtatgcggcagga
actggtttgcaaagctactatcaaaacaatgaagataaccttaaagtgctgcaaacgatg
tttagagactctgctttcttccggtcgcttattgatacactgcaaatggcaatcgctaaa
gcggatttgctgattgcagaggagtacgctgggatgtcggataatgaagaagcacgacaa
cgtatatttggacagatttctgcagagttcaagctgacatctgagttgattttgaaaata
accggacaatccgagattttggacgatgtacctgttattcaggaatctatccggttgcgt
aatccttatgtcgatccgttaagttatttgcaggttcaattgctaagtgagctgcgcgag
ttgcgtaatcagaacggtgatgatgctgaaatgctgcgtgaggtactgttgacgattaac
ggaattgccgcaggcttgagaaacacaggctga

DBGET integrated database retrieval system