KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_176592Help
Entry
PHYPADRAFT_176592 CDS       T01041                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    PHYPADRAFT_176592
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PHYPADRAFT_176592
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
AA seq 157 aa AA seqDB search
MAPLKAICVLAGPSDSVTGVISFVQDGAGPTIVEGTVKGLNPGKHGFHVHALGDTTNGCM
STGPHFNPKGLEHGAPEDEVRHAGDLGNVIAGEDGIAKVSLKDAHIPLGGPNSIIGRAVV
VHADPDDLGKGGHELSKSTGNAGARIACGIIGFQASA
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggctcctctgaaggctatctgcgtgctcgctggcccctccgacagcgttaccggcgtc
atctcctttgtacaagacggagctggcccgacgattgtggagggaacagtgaaggggttg
aaccctggcaaacatggatttcatgtccatgcactaggggacacaaccaatggctgcatg
tctactggtcctcatttcaaccccaagggtctagagcatggtgcccccgaggatgaagtt
cgtcatgcgggagacttgggtaacgtcatcgccggcgaagatggcattgccaaggtttcc
ctgaaagatgctcatattcctttgggtggtccaaactcaattatcggtcgcgcagtggtt
gttcatgctgatcctgatgacctcggaaaaggtggacacgagctaagcaagtctactgga
aatgccggtgcccgcattgcgtgtggaattattggatttcaggcttcagcttga

DBGET integrated database retrieval system