KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_198425Help
Entry
PHYPADRAFT_198425 CDS       T01041                                 

Definition
(RefSeq) hypothetical protein
  KO
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    PHYPADRAFT_198425
Enzymes [BR:ppp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     PHYPADRAFT_198425
Chromosome [BR:ppp03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     PHYPADRAFT_198425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
AA seq 690 aa AA seqDB search
MLRQGSNTARGTLACALCTEKFAEMPSLGKHWKEDHKEEANMFQKGAACCECRQNYYDRR
ELLMHWKSTHPTLPIGDLGMTVCVICDEKFKNFDLLWLHVEDQHFLEFSSAKFVDHVKEG
MSRAGNALKCTVCWEEFDIELEVCNHKGIVHNGLSPGRFKCKFCGQRFKLLPDLGRHHQA
EHRKSTSKVSPNMEGLQIKRRRRRKRMEVLQDMKLVPSKRKQGGFAKHIVQRMRAVQQSQ
HERHGSNEPLVDAKTVSKIPSQRVLNVTGWPTSAEMLNAARVACCKDFMYRELAKKHTNL
HQSLHLQVIALCSAMGVDIQWQADAFICPNQCSPFHAAGAAAPLLDVDMAGFSEAPFKAQ
ADLFDDIGPTLLKTIDMKDFMKGKHMVIHEDLSNGQEPVPIPCVIDEDLLRPCTCANCCE
NGINAALEVAEPWKTFSYINKRLLDPSLGLDTESSKLGCACGEGRCDSGHCDHVLMFDND
NGEACDKSGVAIKGRFPYDAQGRIILEEGYMVYECNSSCLCREDCQNRVLQKGVRVKLEV
FKSRHKGWAVRSAQPIPSGTFVCEYIGEVVNDREANQRGVRYDQDGCSYLYDIDAHLDMS
ISRAGAKPFVIDATKHGNVARFINHSCAPNLINYEVLVESMDCQLAHIGFFANRDISAGE
ELAYDYRYKLLPGKGCACHCGVSTCRGRLY
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgttgagacaaggaagtaataccgccaggggcacgctcgcatgtgctctttgcaccgaa
aagtttgcagagatgccctctctagggaagcattggaaggaagatcataaggaagaggct
aatatgtttcagaaaggggcagcatgttgtgaatgtagacagaactactacgatagaagg
gaattgcttatgcactggaagtctacccatcctacactaccaattggtgaccttggtatg
actgtgtgcgtgatatgtgacgagaagtttaagaattttgacctgctatggttgcatgtt
gaggatcaacacttccttgaatttagtagcgcgaaatttgtggatcacgtaaaggagggc
atgtcaagagcaggaaatgcgttgaagtgcacagtgtgttgggaagagtttgatatagag
ttggaggtttgtaatcataaagggattgttcacaatggcctttcccccggcagattcaag
tgcaagttctgtggacagagatttaaacttttaccagacttgggaagacatcatcaagct
gagcatcgaaaatctactagtaaggtttccccaaatatggaaggtttgcaaattaaacgg
cggcggcgacgaaagagaatggaagtcctgcaggatatgaagttggttccttcgaagaga
aagcaaggagggtttgccaagcatatcgttcagcgtatgagggcagtacagcagagtcag
catgagcgacatgggtccaatgaaccattagtagatgccaagaccgtctctaaaattcca
tctcagcgagttttaaatgtaactggatggcccacgagtgctgagatgcttaatgctgct
cgtgttgcatgctgcaaagacttcatgtacagagaattagcaaagaagcataccaattta
catcaaagtcttcaccttcaagttatagctctatgttcagcaatgggagttgacattcag
tggcaggcagatgcctttatttgtcccaatcaatgttcacccttccatgctgcgggtgca
gctgctccacttttggatgttgacatggctggattttctgaagcccctttcaaagcccaa
gctgatctttttgacgacatagggccaacacttctgaagactatcgatatgaaagatttt
atgaaaggaaagcatatggtgatccatgaggatttgagtaatggccaagaaccagtacca
attccatgtgtgattgatgaagatcttttaaggccctgtacatgtgccaattgttgtgaa
aatggcataaacgctgctctggaggttgccgagccgtggaaaacattcagctacatcaat
aaaaggctgctggacccgtcactaggtctcgatactgagagttcgaaacttggatgcgca
tgtggagaaggtaggtgtgattctggccactgtgatcacgtcttgatgtttgacaatgac
aacggggaggcctgcgacaagtcgggagtagctataaaaggtcgattcccttatgatgct
caaggccgaatcattcttgaggagggttacatggtatatgaatgcaattctagctgtctt
tgtcgggaagactgtcagaaccgtgtcttacaaaaaggagttcgagtgaagcttgaagtg
ttcaagtcgcgtcacaagggttgggctgttcggagtgcacagccgattccttctgggacc
ttcgtgtgtgagtatataggcgaagtagtcaatgatcgggaggctaaccagagaggcgta
aggtatgaccaagatggttgcagttacctttatgatatcgatgcacacctggacatgtcg
atctctcgagctggtgcaaaaccgtttgtgattgatgctactaagcatggaaatgtcgct
cgcttcatcaaccatagctgtgctcctaatctgatcaattatgaggtgctggtggaaagc
atggactgtcagctggcccacatcggtttctttgccaatcgagatattagtgcaggggaa
gaacttgcatacgattatagatacaagctactcccaggaaaaggttgtgcatgtcactgt
ggtgtatcgacttgccgcgggcgtttgtactag

DBGET integrated database retrieval system