KEGG   Paenibacillus polymyxa SQR-21: PPSQR21_049170Help
Entry
PPSQR21_049170    CDS       T03178                                 

Definition
(GenBank) alpha amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
ppq  Paenibacillus polymyxa SQR-21
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PPSQR21_049170
Enzymes [BR:ppq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PPSQR21_049170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
5561784..5563277
Genome map
AA seq 497 aa AA seqDB search
MKRNHTMMQFFEWNVAADGSHWKKLARLAPELKAKGIDAIWIPPVTKGQSPEDTGYGVYD
LYDLGEFDQKGAVRTKYGTREDLLEAVASCVRHGVAVYVDLVMNHKAGADETEVFKVVEV
NPDNRNEVISEPFDIEGWTKFTFPGRQGKYSTFQWNFEHFNGTDYDASQDRTGIYRILGK
NKNWSDNVDDEFGNYDYLMFANIDYNHQDVRKEMIRWGKWLVDTLQCNGFRLDAIKHINH
EFVREFATEMIKKRGQDFYMVGEFWKPDLESCQKFLDTIDYKIDLFDVSLHYKLHSASLG
GKDFDLSTIFEDTLVHTHPLNSVTFVDNHDSQPHEALESWVEDWFKPSAYALILLRKDGY
PCVFYGDYYGIQGQTPVKGKQAELDPLLYARYHKAYGEQKDYFDDPHTIGWVRQGIPELH
GSGCAVVITNANDGEKRMFVGKQHAGEKWTDLTGHYDHAVKIEQDGYGVFPVRAGSVSVW
ALPTEEDSLETEDTANA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggaaccatacgatgatgcaatttttcgagtggaatgtcgcagctgacggttct
cactggaaaaagcttgcccgcctggcaccggaactaaaagccaaaggaattgacgcgata
tggattccacctgtcaccaaaggccaatctcctgaggatacgggttacggcgtctatgac
ctttacgatctgggcgaatttgaccaaaagggtgcagtacgcaccaaatacggaaccagg
gaagatctgctggaagctgtcgcatcctgcgttcgccacggcgtagccgtctatgtcgat
ctggtcatgaaccataaggctggtgcagatgaaaccgaagtattcaaggtcgtcgaggtc
aacccggataatcgtaatgaggtcatttccgagccctttgatatcgaaggctggactaaa
tttacattccccggccggcaagggaagtattccacatttcaatggaacttcgaacatttt
aacggaacggattacgatgcaagtcaggaccggacaggaatctatcgtattttaggtaaa
aataaaaactggagcgataatgtagatgatgaattcggcaattatgattatttaatgttc
gccaatattgactataatcatcaggatgtgcgtaaggaaatgatccgctggggcaagtgg
ctggtggatactctacaatgcaacggattccgtctggatgcaatcaagcatattaatcat
gaatttgtacgagagtttgctacagaaatgattaaaaagcgtgggcaggatttttatatg
gtaggcgagttttggaaaccggatctggaatcgtgtcaaaagtttctggataccatcgat
tataaaatcgacctgtttgacgtatccctccactacaaactacatagcgcttccttgggt
ggtaaggatttcgatttaagcaccattttcgaggatacgctggttcatacccatcccctg
aactcggttacttttgtcgataatcatgattcccagccgcatgaagcgctcgaatcctgg
gtggaggactggtttaagcccagtgcctatgcactcatcctactgcgcaaagatggttat
ccctgcgtattctacggggattactacggtatccagggacaaacgcctgtgaaaggcaag
caagctgagctagacccgctcctatatgctcggtaccacaaagcttatggtgagcaaaaa
gattattttgatgatccccatacgattggatgggttcgtcagggcattcctgagctgcac
ggctctggatgtgctgtggtgatcaccaacgcaaatgacggggaaaagcgcatgttcgtg
ggtaaacaacatgcaggagaaaaatggaccgatttgactgggcattacgatcatgccgtg
aagatcgaacaggatggctacggcgtatttcccgttcgtgctggcagtgtatcggtatgg
gcacttcctaccgaggaagacagcctggaaacagaggataccgcgaacgcttga

DBGET integrated database retrieval system