KEGG   Photobacterium profundum: PBPRA3439Help
Entry
PBPRA3439         CDS       T00173                                 

Gene name
SO0217
Definition
(GenBank) putative GTPase-translation elongation factor
  KO
K02358  
elongation factor Tu
Organism
ppr  Photobacterium profundum
Brite
Translation factors [BR:ppr03012]
 Eukaryotic Type
  Elongation factors
   PBPRA3439 (SO0217)
 Prokaryotic Type
   PBPRA3439 (SO0217)
Mitochondrial biogenesis [BR:ppr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PBPRA3439 (SO0217)
Exosome [BR:ppr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PBPRA3439 (SO0217)
  Exosomal proteins of breast cancer cells
   PBPRA3439 (SO0217)
  Exosomal proteins of colorectal cancer cells
   PBPRA3439 (SO0217)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(3892644..3893852)
Genome map
AA seq 402 aa AA seqDB search
MPCLEGLSMSKEKFERLKPHVNVGTIGHVDHGKTTLTAAICTVLAKVYGGDAKDFASIDN
APEERERGITISTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGGILVVAATDGP
MPQTREHILLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYDFPGDDCPVIM
GSALGALNGEAQWEEKIIELAEALDNYIPEPERAIDLPFILPIEDVFSIQGRGTVVTGRV
EQGIVRIGEEVAIIGIKETTTTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDDVERGQV
LAKPGSITPHTTFESEIYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVM
PGDNIQMKVTLIAPIAMDEGLRFAIREGGRTVGAGVVAKIFE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgtctagagggactatccatgtctaaagaaaaatttgaacgtctaaaaccgcat
gttaacgttggtacaatcggccacgtcgatcacggtaaaacaactctaactgctgctatc
tgtactgtacttgcaaaagtgtacggtggtgatgcaaaagacttcgcttctatcgataac
gctccagaagagcgcgagcgcggtatcacaatttctacttctcacgtagaatatgatact
cctgctcgccactatgcacacgttgactgtcctggacacgccgattatgttaaaaacatg
atcactggtgctgctcaaatggatggtggtatcctagttgttgctgcaactgatggccct
atgccacaaacacgtgagcacatccttcttggtcgtcaggttggtattccttacatcatc
gtattcatgaacaaatgtgacatggttgatgatgaagagctactagaattagtagaaatg
gaagttcgtgaacttctatctgaatacgatttcccaggtgatgattgcccagtaatcatg
ggttctgcactaggtgcacttaacggtgaagctcagtgggaagagaaaatcattgaacta
gctgaagctctagataactacatcccagagccagagcgtgcaattgatcttccattcatc
cttccaatcgaagatgttttctcaattcaaggccgtggtactgttgtaactggtcgtgtt
gagcaaggtatcgtacgtattggtgaagaagttgcaatcatcggtatcaaagagactacc
actactacatgtactggtgttgaaatgttccgtaagcttcttgacgaaggccgtgctggt
gagaacgttggtgttcttctacgtggtactaagcgtgatgacgttgaacgtggtcaagtt
cttgctaagcctggttcaatcaccccgcacactacgtttgagtcagaaatctacgttctg
tctaaagatgaaggtggtcgtcacactcctttcttcaaaggctaccgtccacagttctac
ttccgtacgactgatgtaacgggtactattgaattgccagaaggcgttgagatggttatg
cctggcgataacattcagatgaaagttacgctaattgcgcctatcgcgatggatgaaggt
ctgcgctttgcgatccgtgaaggtggtcgtacagttggtgctggtgttgttgccaagatc
tttgaataa

DBGET integrated database retrieval system