KEGG   Photobacterium profundum: PBPRB0014Help
Entry
PBPRB0014         CDS       T00173                                 

Definition
(GenBank) hypothetical acyltransferase family protein
Organism
ppr  Photobacterium profundum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:19200..22037
Genome map
AA seq 945 aa AA seqDB search
MPVDSESPLGREPEQTAQSVLNVIKELVKELRQGQEPPEPIQLDCDFDRDLGFDSLARAE
LIQRIEQQFKVNLPDQTLAVIETPRDLLRELLHAESQDTALVSEQIIRQIKLGAVESAPE
QMETLQQVLDWHVKEHPDRPHLYVYQNADQVTEISYRALRDEALRIASGLVKQDVEPGQC
IAIMLPTSNDYFYSFFGILFARAIPVPIYPPARPSQIEDHLKRHARILQNSQVRILITVP
EAKPLSQLLRLQVPSIQAVVTVPELRQAASGPLSTGDAQSSDIAFLQYTSGSTGNPKGVA
LTHANLLANVRTMGRVVCVDSTDVFVSWLPVYHDMGLIGTWFGSLYHAIPLVIMSPLLFL
SKPQRWLWAIHHHRGTLSPAPNFAYELCINKIDDAELEGLDLSTWRLSWNGAEPVSPSTI
RRFTERFAKYGFRPETMSPVYGLAECSVGLTFPTSVRLPLIERIRREPMERFGRAITAAA
DETDVMQIVGLGQPLPGHQIRIVDEFGRELPEREEGGLEFKGPSATQGYYRDPEKTQQLF
HGEWLDTGDRAFMVGGELFITGRSKDIIIRAGRNIHPHELEEAVCNIPGIRKGCVAAFAS
HDSHSGTERLIVLAETRETDKVQQQRLQQEVNNLSLDLLGSPPDEVVIAPPHTVPKTSSG
KIRRAACKDLYEQNKLDARQRTVWWQTLRLMMAGINPQLRRYWRIVSDFSYAAYMWLVMA
VLAPCVWCLVAVVPNKRWCWSVARLGVRLLILFTGTRVTMKGKENLPDNTPCILVANHSS
YLDGLIMALAAPTECNFVAKAELLKNPFARIFLSRLDTEFVERFDMQKGVTDARRIAANA
RNNRSLFFFPEGTLYRMPGLHEFHMGAFIAAVDGALPVVPITLCGTRSKLRGKSLFPRRG
DISVTIGKPLTPQGTDWNAALALRDQARAEILSHCGEPDLAHIEK
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcgactccgaaagtccgctaggtcgtgagccagagcaaacagcgcaatcagta
ctgaatgtcattaaagaactagttaaagaactgcggcaagggcaggaaccccctgagccg
attcagctcgattgtgattttgaccgtgatctggggtttgacagccttgcccgtgccgag
ttgatccaacgtatagaacagcagtttaaggtaaacctgcccgatcaaacgctggcagtg
atagaaacaccacgggatttgttacgggaactgcttcacgcagagagccaggacacagct
ttagtgtctgaacaaattatcaggcagattaagctcggggccgtcgaatccgcgcctgaa
cagatggagaccctgcagcaagtccttgactggcatgtgaaagagcatcctgaccgtccg
cacctttatgtttatcagaatgccgatcaggtaacagagatcagttaccgggcattgcgg
gatgaagcattgcggattgcatccgggctggtgaagcaagatgttgaacccggtcagtgc
attgccattatgctgccgaccagcaatgactatttttacagttttttcgggatactgttt
gccagagccattccagttcctatctaccccccggcacggccttcacagatagaagatcac
ttaaagcgccatgcccgtattctgcaaaactctcaggtgcgtatcctgatcactgtcccg
gaagccaagccgctctcgcaattgcttcggcttcaggtgccttctattcaagccgtggtc
actgttcctgagctaaggcaagccgcctccggaccgctctctacgggtgatgctcagagt
tcggatattgcctttttacagtatacatctggcagtaccggaaaccccaaaggagtagct
ttgacgcatgccaacctgcttgctaacgtgcggactatgggcagagtcgtgtgcgtcgat
tcgaccgatgtttttgtcagctggctgccggtataccacgacatggggttgatcggtacc
tggttcggcagcctgtatcacgctatccccttagtgatcatgtcgcccttgttgtttttg
tccaaacctcagcgctggctgtgggcgatacatcatcatcgcggtactttgtcaccggca
cccaattttgcgtatgagttatgtatcaacaaaatcgacgatgccgagcttgagggatta
gatctcagcacctggcggctgtcatggaatggcgctgagcctgtcagcccgagcacgata
cgtcgctttactgagcgattcgctaaatatggctttcgccccgaaaccatgtcaccagtt
tatggattggcagaatgctctgttggcctgaccttcccgaccagtgtgcgtcttcccctg
attgagcgtatcagacgtgagccaatggagcgttttggccgggcgattacggcagcagca
gatgagacggatgtcatgcagatagtgggcttaggtcagccgctgccgggacaccagatc
cgtattgttgacgaatttggcagggagttaccggagcgggaggaaggagggttggagttt
aaagggccttccgctacccaggggtattatcgggatccggaaaagacgcaacagttgttt
catggtgaatggcttgataccggagaccgagcctttatggttggtggcgagctgtttatt
accggacggagcaaagatattattattcgtgctggtcgaaacattcatccccacgaactg
gaagaagcggtgtgcaatatcccggggatccgaaaaggctgtgtcgcggcatttgccagt
catgacagccattccggcactgagcggttgattgtactggcggaaacacgtgaaaccgac
aaagtgcagcaacagcgactacagcaggaagtaaacaacctttctctggatctgctgggt
agtcccccagatgaagtggtgatcgcaccgcctcataccgtacctaaaacctccagcggc
aaaattcgtcgcgcagcatgcaaagatctttacgagcaaaataaactcgatgcccggcaa
cgtaccgtgtggtggcagacgcttcgtttgatgatggcaggaataaatcctcagctgagg
cgctactggcgaatagtttcagattttagttatgcagcttacatgtggctggttatggcc
gtccttgcgccatgtgtctggtgcctggttgcggtcgttcccaataaacgctggtgctgg
tcggttgccaggcttggcgttcgcttactgatcttgtttaccggaaccagggtaacgatg
aaggggaaggaaaacctgcctgataataccccctgtatcttggttgctaaccattccagc
taccttgatgggctgataatggcgctggcagccccgacagaatgtaattttgttgccaag
gcggagctattgaaaaatcctttcgcccgcatttttctgtcccggctggataccgaattt
gttgagcgttttgatatgcaaaaaggtgtgaccgatgcccggcggatagcggccaatgcc
aggaacaaccgctccctgttcttttttcccgaaggaaccttatatcgaatgcccggactt
cacgagtttcatatgggggcgtttatagctgcggtcgatggtgctctgcctgtcgtgcca
atcaccctttgtggtacacgctcaaaactgcgtggtaaatctctatttcccagacgggga
gatatcagcgtgacgattggcaaaccgctgactccacaagggactgactggaatgcagcc
ctcgctctgagggatcaggccagagctgaaattctgagccattgtggtgaaccggatttg
gcacacatagaaaagtaa

DBGET integrated database retrieval system