KEGG   Pseudomonas protegens CHA0: PFLCHA0_c02660Help
Entry
PFLCHA0_c02660    CDS       T02671                                 

Gene name
fadD1
Definition
(GenBank) putative fatty-acid--CoA ligase FadD
Organism
pprc  Pseudomonas protegens CHA0
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
307429..309291
Genome map
AA seq 620 aa AA seqDB search
MNYAVPRDYLNDVNPAISAHVAVDDLPLAEVPGIECLSSVTEVLAYRAWRQPDAIAFIHL
LDGEREEASISYAELWKRSQRLAAALQIFEPREKRVLMLFETGIDYIVSLFGLLLAGAVA
IPAFPPVGTRGLERLALICADAHPQLVLTSSRFMRSQERVNALLQGDLPAPQWVDPEQLA
EADSSWRGQALAHGQLALLQYTSGSTSAPKGVMLTHDNLYSNCRSASQWMGPARNRVGCS
WLPPYHDMGLMGGILQPIFDAFPTVLISPGHFVQRPLRWLDAVSRYGADVTIAPNFAFDL
CVENITDEELAELDLSKLKAIYCGAEPVRQSTLARFSERFAAAGFNPAALGPCYGLAEAT
VLVSGKRHDEPAFNTQVDRDQLASGTLAIVDAEDARALPLVSSGRVAPGLRVAIVDPVSL
QPVADGQIGEIWVQGDNVGAGYWGKEALSQQVFRASLPGIHGRFMRTGDLGALHRDELFV
TGRLKDLIIIAGRNLYPQDLELAVESADPRIRSNGCVAVGIDNGQQEQLAIVAEVKRSEK
LDEAQQEQLRQVITSALVSQFGVAPARIHLAPMGGIPLTTSGKVQRQATRKALLNDTLAR
YGASRAAAAPTLKTATDALS
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgccgtgcctcgtgattatcttaatgatgtcaatccagccatctcagcgcat
gtagcagttgatgatctgccgttggctgaagtcccgggcatcgaatgtttaagttcggtt
accgaagtactggcctatcgcgcatggcggcaacccgatgccattgccttcatccatctg
ctcgatggcgagcgggaggaggcgtcgatcagctacgccgaactgtggaagcgtagtcaa
cgattggccgccgcgctgcagatcttcgagccccgtgaaaaacgggtgctgatgctgttc
gagaccggtatcgactacatcgtttcactgttcggcctgctgctggccggtgccgtggcg
atcccggcctttcccccagtggggacccgggggctggagcggctggcactgatctgcgct
gatgcccatccgcaactggtgctcaccagctcgcgcttcatgcggtcccaggagcgggtc
aacgctctgctccagggtgatttgcccgcgccccagtgggttgacccggagcagttggcc
gaggcggattcatcctggcgcgggcaggcgctcgcccacggccaactggccctgctgcaa
tacacctcgggctccacctcggcgcccaagggcgtgatgctgacccacgacaacctctac
agtaattgccgcagtgccagccagtggatgggcccggccaggaatcgcgtgggttgcagc
tggctgccgccctatcacgacatgggcctgatgggcggaatcctgcagccgatcttcgat
gccttccctaccgtgctcatcagccccgggcactttgtccagcggccgctgcgctggctg
gatgcggtgtccaggtacggcgccgacgtcaccatcgcgcccaacttcgccttcgacctg
tgtgtcgaaaacatcaccgacgaggaactggcagagctcgacctgagcaagctcaaggct
atctattgcggggccgagccggtgcgccagagcaccctggcgcgcttctccgaacgtttt
gccgccgccggcttcaacccggcggccctgggcccctgctacgggttggccgaggccacc
gtactggtctcgggcaagcgccacgatgagccggcgttcaatacccaggtggatcgggac
caactcgccagtggcaccctggccattgtcgatgccgaggatgcccgggccctgccgctg
gtcagtagcggcagggtcgccccgggcctgcgtgtggcgattgtcgaccctgtcagcctg
caaccggtggcggacggccagatcggcgagatctgggtccagggcgacaacgtgggcgcc
ggctactggggcaaggaagcgctgagccagcaggtgtttcgcgccagcctgccgggcatc
catgggcgtttcatgcgcaccggcgatcttggcgcgctgcaccgcgatgagctgttcgtc
accgggcgcctcaaggacctgatcatcattgccgggcgcaacctgtatccccaggacctg
gagctggcggtggaaagcgccgacccgcgcatccgcagcaacggctgcgtggcggtgggc
atcgataacggtcagcaggaacaactggcgatcgtggccgaggtcaagcgcagcgagaaa
ctcgatgaagcccagcaggaacagctgcgccaggtgatcaccagtgcgctggtcagccag
ttcggcgtggccccggcacgcatccacctggcgcccatgggcggcattccactgaccacc
agtggcaaggtccagcgccaggccacccgcaaggccctgctcaacgacacgctggcgcgc
tatggcgccagtcgcgcggctgcggcacctacccttaaaactgcaacggatgccctgtca
tga

DBGET integrated database retrieval system