KEGG   Pseudomonas protegens CHA0: PFLCHA0_c21830Help
Entry
PFLCHA0_c21830    CDS       T02671                                 

Gene name
pphA
Definition
(GenBank) phosphonopyruvate hydrolase PphA
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pprc00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    PFLCHA0_c21830 (pphA)
Enzymes [BR:pprc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     PFLCHA0_c21830 (pphA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2395710..2396600
Genome map
AA seq 296 aa AA seqDB search
MQEADIRRTNLSQLLRRKRCLRVLEAHSPISALLAEQSRLERGSGPSLVYDAIWSSSLTD
STHKGLPDIEILSPSNRLHGIREIFDVCSLPMIFDGDTGGKAEHFAIHVKMLDRAGVSAV
VIEDKCGLKKNSLFGNAVSQLQDSIEEFCEKIRVGCANRSHEDLLIIARCESLILDKGMD
DAIERCLAYVAAGADGIMIHSRKKDGLEILEFARLFRRHCPRVPLICVPTSYAHLSFDEL
EGAGFNAVIYANHMLRSAYMAMRDVAVGILEHGRTLEVEPRCLGIDEILDLVPGTR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaagctgatattcgccgaaccaacctgagccagttgctgcgccgcaagcgctgc
cttcgcgtgctcgaagcccacagcccgatctccgctctgctggcggagcaatccaggctg
gagcggggcagcggaccgagcctggtctacgacgccatctggtccagctcccttaccgac
tcgacccacaagggcctgccggacatcgagatcctctcgccgagcaaccgcttgcacggc
atccgcgagatcttcgatgtgtgttcgttgccgatgattttcgacggcgataccgggggc
aaggccgagcacttcgccatccacgtgaagatgctggaccgggccggggtctcggcggtg
gtgatcgaggacaagtgcgggctgaagaagaactcgctgttcggcaacgcggtgagccag
ctccaggactccatcgaggagttctgcgaaaagatccgcgtgggctgcgccaaccgcagc
cacgaggatctgctgatcatcgcccgttgtgaaagcctgatcctcgacaagggcatggac
gatgccatcgagcgctgcctggcctatgtcgcggccggcgccgacgggatcatgatccac
agccgcaagaaggacggcctggagatcctcgagttcgcccggttgttccgccgccactgc
ccgcgtgtgccgctgatctgtgtgcccaccagctacgctcacttgagtttcgacgagctg
gagggggcgggcttcaacgcggtgatctacgccaaccacatgctgcgcagtgcctacatg
gccatgcgtgatgtggcggtggggattctcgagcatggccggaccctggaggtggagccg
cggtgcctgggcatcgacgagatcctcgacctggtgccgggcacccgttag

DBGET integrated database retrieval system