KEGG   Pseudomonas protegens Cab57: PPC_0274Help
Entry
PPC_0274          CDS       T03613                                 

Definition
(GenBank) AMP-binding protein
Organism
ppro  Pseudomonas protegens Cab57
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
306679..308541
Genome map
AA seq 620 aa AA seqDB search
MNYAVPRDYLNDVNPAISAHVAVDDLPLAEVPGIECLSSVTEVLAYRAWRQPDAIAFIHL
LDGEREEASISYAELWKRSQRLAAALQIFEPREKRVLMLFETGIDYIVSLFGLLLAGAVA
IPAFPPVGTRGLERLALICADAHPQLVLTSSRFMRSQERVNALLQGDLPAPQWVDPEQLA
EADSSWRGQALAHGQLALLQYTSGSTSAPKGVMLTHDNLYSNCRSASQWMGPARNRVGCS
WLPPYHDMGLMGGILQPIFDAFPTVLISPGHFVQRPLRWLDAVSRYGADVTIAPNFAFDL
CVENITDEELAELDLSKLKAIYCGAEPVRQSTLARFSERFAAAGFNPAALGPCYGLAEAT
VLVSGKRHDEPAFNTQVDRDQLASGTLAIVDAEDARALPLVSSGRVAPGLRVAIVDPVSL
QPVADGQIGEIWVQGDNVGAGYWGKEALSQQVFRASLPGIHGRFMRTGDLGALHRDELFV
TGRLKDLIIIAGRNLYPQDLELAVESADPRIRSNGCVAVGIDNGQQEQLAIVAEVKRSEK
LDEAQQEQLRQVITSALVSQFGVAPARIHLAPMGGIPLTTSGKVQRQATRKALLNDTLAR
YGASRAAAAPTLKTATDALS
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgccgtgcctcgtgattatcttaatgatgtcaatccagccatatcagcgcat
gtagcagttgatgatctgccgttggccgaagtcccgggcatcgaatgtttaagttcggtt
accgaagtactggcctatcgcgcatggcggcaacccgatgccattgccttcatccatctg
ctagatggcgagcgggaggaggcgtcgatcagctacgccgaactgtggaagcgtagtcaa
cgattggccgccgcgctgcagatcttcgagccccgtgaaaaacgggtgctgatgctgttc
gagaccggtatcgactacatcgtttcactgttcggcctgctgctggccggtgccgtggcg
atcccggcctttcccccagtggggacccgggggctggagcggctggcactgatctgcgct
gatgcccatccgcaactggtgctcaccagctcgcgcttcatgcggtcccaggagcgggtc
aacgctctgctccagggtgatttgcccgcgcctcagtgggttgacccggagcagttggcg
gaggcggattcatcctggcgcgggcaggcgctcgcccacggccaactggccctgctgcaa
tacacctcgggctccacctcggcgcccaagggcgtgatgctgacccacgacaacctctac
agtaattgccgcagtgccagccagtggatgggcccggccaggaatcgcgtgggttgcagc
tggctgccgccctatcacgacatgggcctgatgggcggaatcctgcagccgatcttcgat
gccttccctaccgtgctcatcagccccgggcactttgtccagcggccgctgcgctggctg
gatgcggtgtccaggtacggcgccgacgtcaccatcgcgcccaacttcgccttcgacctg
tgtgtcgaaaacatcaccgacgaggaactggcagagctcgacctgagcaagctcaaggct
atttattgcggggccgagccggtgcgccagagcaccctggcgcgcttttccgaacgtttt
gccgccgccggcttcaacccggcggccctgggcccctgctacgggttggccgaggccacc
gtactggtctcgggcaagcgccacgatgagccggcgttcaatacccaggtggatcgggac
caactcgccagtggcaccctggccatcgtcgatgccgaggatgcccgggccctgccgctg
gtcagtagcggcagggtcgccccgggcctgcgtgtggcgattgtcgaccctgtcagcctg
caaccggtggccgacggccagatcggcgagatctgggtccagggcgacaacgtgggcgcc
ggctactggggcaaggaagcgctgagccagcaggtgtttcgcgccagcctgccgggcatc
catgggcgtttcatgcgcaccggcgatcttggcgctctgcaccgcgatgaactgttcgtc
accgggcgcctcaaggacctgatcatcattgccggacgcaacctgtatccccaggacctg
gagctggcggtggaaagcgccgacccgcgcatccgcagcaacggctgcgtggcggtgggc
atcgataacggccagcaggaacaactggcgatcgtggccgaggtcaagcgcagcgagaaa
ctcgatgaagcccagcaggaacaactgcgccaggtgatcaccagtgcgctggtcagccag
ttcggcgtggccccggcgcgcatccacctggcgcccatgggcggcattccactgaccacc
agtggcaaggtccagcgccaggccacccgcaaggccctgctcaacgacacgctggcgcgt
tatggcgccagtcgcgcggctgcggcacctacccttaaaactgctacggatgccctgtca
tga

DBGET integrated database retrieval system