KEGG   Pseudomonas protegens Cab57: PPC_5537Help
Entry
PPC_5537          CDS       T03613                                 

Gene name
tuf_2
Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
ppro  Pseudomonas protegens Cab57
Brite
Translation factors [BR:ppro03012]
 Eukaryotic Type
  Elongation factors
   PPC_5537 (tuf_2)
 Prokaryotic Type
   PPC_5537 (tuf_2)
Mitochondrial biogenesis [BR:ppro03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PPC_5537 (tuf_2)
Exosome [BR:ppro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PPC_5537 (tuf_2)
  Exosomal proteins of breast cancer cells
   PPC_5537 (tuf_2)
  Exosomal proteins of colorectal cancer cells
   PPC_5537 (tuf_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(6118321..6119514)
Genome map
AA seq 397 aa AA seqDB search
MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSARVDFDKIDSAPEEKARG
ITINTAHVEYDSNIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSALMALN
GQDDNEMGTTAVKRLVETLDTYIPEPERAIDKPFLMPIEDVFSISGRGTVVTGRVERGIV
RIQEEVEIVGLRDTQKTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDDVERGQVLVKPG
TVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
QMTVTLIKTIAMEDGLRFAIREGGRTVGAGVVAKVIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaagaaaaatttgaacgtaacaaaccgcacgtcaacgttggcactatcggtcac
gttgaccacggtaaaaccactctgaccgctgctctgactcgcgtttgctccgaagttttc
ggttcggctcgtgttgacttcgacaagatcgacagcgccccagaagaaaaagctcgtggt
atcaccatcaacactgcgcacgtagagtacgactcgaatattcgtcactacgcgcacgtt
gactgcccaggtcacgccgactacgtcaaaaacatgatcactggtgctgcccagatggac
ggcgcgatcctggtttgctcggctgccgatggtccgatgccacaaactcgtgagcacatc
ctgctgtcccgtcaggtaggcgttccgtacattgttgtcttcctgaacaaggctgacatg
gttgacgacgctgagctgctggaactggttgagatggaagtgcgcgatctgctgagcact
tacgacttcccaggtgacgacactccgatcatcatcggttcggctctgatggctctgaac
ggccaagacgacaacgaaatgggtaccaccgctgttaagcgtctggtagaaactctggat
acctacatcccagagccagagcgtgcaatcgacaagccgttcctgatgccaatcgaagac
gtgttctcgatctccggtcgtggcaccgtggtaactggccgtgttgagcgtggtatcgtt
cgcatccaggaagaagttgagatcgttggtctgcgcgacactcagaaaactacctgcacc
ggcgttgaaatgttccgcaagctgctcgacgaaggtcgtgctggcgagaactgcggcgtt
ctgctgcgtggtaccaagcgtgacgacgttgagcgtggccaggttctggttaagccaggc
accgttaagccgcacaccaagttcaccgctgaagtttacgttctgagcaaggaagaaggc
ggccgtcatactccgttcttcaaaggctaccgtccacagttctacttccgtactactgac
gtgactggtaactgcgagctgccagaaggcgttgaaatggtaatgccaggtgacaacatc
cagatgactgtcactctgatcaaaaccatcgcgatggaagatggtctgcgtttcgctatc
cgtgaaggcggtcgtaccgtcggcgctggcgtcgtagccaaagtcatcgagtaa

DBGET integrated database retrieval system