KEGG   Pan paniscus (bonobo): 100982628Help
Entry
100982628         CDS       T02283                                 

Gene name
NEU3
Definition
(RefSeq) neuraminidase 3
  KO
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
pps  Pan paniscus (bonobo)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100982628 (NEU3)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100982628 (NEU3)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     100982628 (NEU3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
11
AA seq 629 aa AA seqDB search
MLWTSGPFCRVPSEAGNLCSTLRLSREALGGDTELQTNIRARGCGTEERRRPLGTEVGPG
LELSWRGWRWCRSHAVVGTEMRAGGRGSAEGAGRXRARGVGQRLAPTATDYSLRPPXFVA
VTCFRQSTRSSLLGACLRVFRLCCFSLSILLCLSLPSLGAGASSGLRRMRPADLPPRPME
ESPASSSAPTETEEPGSSAEVMEEVTTCSFNSPLFRQEDDRGITYRIPALLYIPPTHTFL
AFAEKRSTRRDEDALHLVLRRGLRIGQLVQWGPLKPLMEATLPGHRTMNPCPVWEQKSGC
VFLFFICVRGHVTERQQIVSGRNAARLCFIYSQDAGCSWSEVRDLTEEVIGSELKHWATF
AVGPGHGIQLQSGRLVIPAYTYYIPSWFFCFQLPCKTRPHSLMIYSDDLGVTWHHGRLIR
PMVTVECEVAEVTGRAGHPVLYCSARTPNRCRAEALSTDHGEGFQRLALSRQLCEPPHGC
QGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEARTPSESWLLYSHPTSRKQ
RVDLGIYLNQTPLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFECGTKQECEQIAF
RLFTHREILSHLQGDCTSPGRNPSQFKSN
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgctctggacctctggtcctttttgtagggtaccctctgaggccgggaacctttgctca
actctcaggctgtccagggaagctttaggcggtgataccgagctacagaccaatataaga
gctcggggctgtggcactgaagagaggaggcggccgttgggaactgaggtgggcccaggg
cttgagctgagttggcgagggtggaggtggtgccggtcccacgccgtggtggggaccgag
atgcgggctggagggaggggcagcgccgagggggcgggacggnggagggctcgcggagta
ggccaacggttggccccaaccgccactgactacagcctgcgcccgcctnncttcgttgcc
gttacctgtttccggcagtcgacacgctcttcgcttctcggggcttgtctccgtgtcttc
cgtctctgttgtttctccctctctatcctcctctgtctcagtctccccagccttggggcc
ggtgcctcttccgggcttcggcgaatgagacctgcggacctgcccccgcgccccatggaa
gaatccccggcgtccagctctgccccgacagagacggaggagccggggtccagtgcagag
gtcatggaagaagtgacaacatgctccttcaacagccctctgttccggcaggaagatgac
agagggattacctaccggatcccagccctgctctacataccccccacccacaccttcctg
gcctttgcagagaagcgttccacgaggagagatgaggatgctctccacctggtgctgagg
cgagggttgaggattgggcagttggtacagtgggggcccctgaagccactgatggaagcc
acactaccggggcatcggaccatgaacccctgtcctgtatgggagcagaagagtggttgt
gtgttcctgttcttcatctgtgtgcggggccatgtcacagagcgtcaacagattgtgtca
ggcaggaatgctgcccgcctttgcttcatctacagtcaggatgctggatgttcatggagt
gaggtgagggacttgactgaggaggtcattggctcagagctgaagcactgggccacattt
gctgtgggcccaggtcatggcatccagctgcagtcagggagactggtcatccctgcgtat
acctactacatcccttcctggttcttttgcttccagctaccatgtaaaaccaggcctcat
tctctgatgatctacagtgatgacctaggggtcacatggcaccatggtagactcattagg
cccatggttacagtagaatgtgaagtggcagaggtgactgggagggctggccaccctgtg
ctatattgcagtgcccggacaccaaacaggtgccgggcagaggcgctcagcactgaccat
ggtgaaggctttcagagactggccctgagtcgacagctctgtgagcccccacatggttgc
caagggagtgtggtaagtttccggcccctggagatcccacataggtgccaggactctagc
agcaaagatgcacccaccattcagcagagctctccaggcagttcactgaggctggaggag
gaagctagaacaccgtcagaatcatggctcttgtactcacacccaaccagtaggaaacag
agggttgacctaggtatctatctcaaccagacccccttggaggctgcctgctggtcccgc
ccctggatcttgcactgtgggccctgtggctactctgatctggctgctctggaggaggag
ggcttgtttgggtgtttgtttgaatgtgggaccaagcaagagtgtgagcagattgccttc
cgcctgtttacacaccgggagatcctgagtcacctgcagggggactgcaccagccctggt
aggaacccaagccaattcaaaagcaattaa

DBGET integrated database retrieval system