KEGG   Pan paniscus (bonobo): 100983091Help
Entry
100983091         CDS       T02283                                 

Gene name
GNG7
Definition
(RefSeq) G protein subunit gamma 7
  KO
K04543  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04014  Ras signaling pathway
pps04062  Chemokine signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04371  Apelin signaling pathway
pps04713  Circadian entrainment
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04726  Serotonergic synapse
pps04727  GABAergic synapse
pps04728  Dopaminergic synapse
pps04740  Olfactory transduction
pps04926  Relaxin signaling pathway
pps05032  Morphine addiction
pps05034  Alcoholism
pps05167  Kaposi's sarcoma-associated herpesvirus infection
pps05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100983091 (GNG7)
   04371 Apelin signaling pathway
    100983091 (GNG7)
   04151 PI3K-Akt signaling pathway
    100983091 (GNG7)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    100983091 (GNG7)
  Endocrine system
   04926 Relaxin signaling pathway
    100983091 (GNG7)
  Nervous system
   04724 Glutamatergic synapse
    100983091 (GNG7)
   04727 GABAergic synapse
    100983091 (GNG7)
   04725 Cholinergic synapse
    100983091 (GNG7)
   04728 Dopaminergic synapse
    100983091 (GNG7)
   04726 Serotonergic synapse
    100983091 (GNG7)
   04723 Retrograde endocannabinoid signaling
    100983091 (GNG7)
  Sensory system
   04740 Olfactory transduction
    100983091 (GNG7)
  Environmental adaptation
   04713 Circadian entrainment
    100983091 (GNG7)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100983091 (GNG7)
  Substance dependence
   05032 Morphine addiction
    100983091 (GNG7)
   05034 Alcoholism
    100983091 (GNG7)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100983091 (GNG7)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100983091 (GNG7)
  Exosomal proteins of other body fluids (saliva and urine)
   100983091 (GNG7)
GTP-binding proteins [BR:pps04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100983091 (GNG7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma CP12
Motif
Other DBs
NCBI-GeneID: 100983091
NCBI-ProteinID: XP_008970839
LinkDB All DBs
Position
19
AA seq 68 aa AA seqDB search
MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFK
DKKPCIIL
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccactaacaacatagcccaggcccggaagctggtggaacagctacgcatagaa
gccgggattgagcgcatcaaggtctctaaagcggcgtctgacctcatgagctactgtgag
caacacgcccggaatgaccccctgctggtcggagtccctgcctccgagaacccctttaag
gacaagaaaccttgtattattttataa

DBGET integrated database retrieval system