KEGG   Pan paniscus (bonobo): 100992436Help
Entry
100992436         CDS       T02283                                 

Gene name
GAD2
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00250  Alanine, aspartate and glutamate metabolism
pps00410  beta-Alanine metabolism
pps00430  Taurine and hypotaurine metabolism
pps00650  Butanoate metabolism
pps01100  Metabolic pathways
pps04727  GABAergic synapse
pps04940  Type I diabetes mellitus
Module
pps_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100992436 (GAD2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100992436 (GAD2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100992436 (GAD2)
   00430 Taurine and hypotaurine metabolism
    100992436 (GAD2)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    100992436 (GAD2)
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100992436 (GAD2)
Enzymes [BR:pps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100992436 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 100992436
NCBI-ProteinID: XP_014201880
LinkDB All DBs
Position
10
AA seq 585 aa AA seqDB search
MASPGSGFWSFGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGG
SQPPRAAAXKAACTCDQKPCSCSKVDVNYAFLHATDLLPACDGERPTLAFLQDVMNILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
PGGAISNMYAMMIARFKMFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
MHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQ
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEY
LYNIIKNREGYEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEY
GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcatctccgggctctggcttttggtctttcgggtcggaagatggctctggggattcc
gagaatcccggcacagcgcgagcctggtgccaagtggctcagaagttcacgggcggcatc
ggaaacaaactgtgcgccctgctctacggagatgccgagaagccggcggagagcggcggg
agccaacccccgcgggccgccgccnngaaggccgcctgcacctgcgaccagaagccctgc
agctgctccaaagtggatgtcaactacgcgtttctccatgcaacagacctgctgccggcg
tgtgatggagaaaggcccactttggcgtttctgcaagatgttatgaacattttacttcag
tatgtggtgaaaagtttcgatagatcaaccaaagtgattgatttccattaccctaatgag
cttctccaagaatataattgggaattggcagaccaaccacaaaatttggaggaaattttg
atgcattgccaaacaactctaaaatatgcaattaaaacagggcatcctagatacttcaat
caactttccactggattggatatggttggattagcagcagactggctgacatcaacagca
aatactaacatgttcacctatgaaattgctccagtatttgtgcttttggaatatgtcaca
ctaaagaaaatgagagaaatcattggctggccagggggctctggcgatgggatattttct
cccggtggcgccatatctaacatgtatgccatgatgatcgcacgctttaagatgttcccg
gaagtcaaggagaaaggaatggctgctgttcccaggctcattgccttcacgtctgagcat
agtcatttttctctcaagaagggagctgcagccttagggattggaacagacagtgtgatt
ctgattaaatgtgatgagagagggaaaatgattccatctgatcttgaaagaaggattctt
gaagccaaacagaaagggtttgttcctttcctcgtgagtgccacagctggaaccaccgtg
tatggagcatttgaccccctcttagctgttgctgacatttgcaaaaagtataagatctgg
atgcatgtggatgcagcttggggtgggggattactgatgtcccgaaaacacaagtggaaa
ctgagtggcgtggagagggccaactctgtgacgtggaatccacacaagatgatgggagtc
cctttgcagtgctctgctctcctggttagagaagagggattgatgcagaattgcaaccaa
atgcatgcctcctacctctttcagcaagataaacattatgacctgtcctatgacactgga
gacaaggccttacagtgcggacgccacgttgatgtttttaaactatggctgatgtggagg
gcaaaggggactaccgggtttgaagcgcatgttgataaatgtttggagttggcagagtat
ttatataacatcataaaaaaccgagaaggatatgagatggtgtttgatgggaagcctcag
cacacaaatgtctgcttctggtacattcctccaagcttgcgtactctggaagacaatgaa
gagagaatgagtcgcctctcgaaggtggctccagtgattaaagccagaatgatggagtat
ggaaccacaatggtcagctaccaacccttgggagacaaggtcaatttcttccgcatggtc
atctcaaacccagcggcaactcaccaagacattgacttcctgattgaagaaatagaacgc
cttggacaagatttataa

DBGET integrated database retrieval system