KEGG   Pan paniscus (bonobo): 100993449Help
Entry
100993449         CDS       T02283                                 

Gene name
ALPI
Definition
(RefSeq) alkaline phosphatase, intestinal
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00730  Thiamine metabolism
pps00790  Folate biosynthesis
pps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    100993449 (ALPI)
   00790 Folate biosynthesis
    100993449 (ALPI)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100993449 (ALPI)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100993449 (ALPI)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pps00537]
 Enzymes
  100993449 (ALPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 100993449
NCBI-ProteinID: XP_003813194
LinkDB All DBs
Position
2B
AA seq 528 aa AA seqDB search
MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLG
DGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLC
GVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYA
HTVNRNWYSDADMPASARQDGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPGDA
SQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELVQASLDPSVTHLMGLFEPGDTKYEIHRD
PTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERA
GQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVF
NSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHV
MAFAACLEPYTACDLAPPACPTDAAHPVAASLPLLAGTLLLLGASAAP
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggccctgggtgctgctgctgctgggcctgaggctacagctctccctgggcgtc
atcccagctgaggaggagaacccggccttctggaaccgccaggcagctgaggccctggat
gctgccaagaagctgcagcccatccagaaggtcgccaagaacctcatcctcttcctgggc
gatgggttgggggtgcccacggtgacagccaccaggatcctaaaggggcagaagaatggc
aaactggggcctgagacacccctggccatggaccgcttcccatacctggctctgtccaag
acatacaatgtggacagacaggtgccagacagcgcagccacagccacggcctacctgtgc
ggggtcaaggccaacttccagaccatcggcttgagtgcagccgcccgctttaaccagtgc
aacacgacacgcggcaatgaggtcatctccgtgatgaaccgggccaagcaagcaggaaag
tcagtaggagtggtgaccaccacacgggtgcagcacgcctcgccagccggcacctacgca
catacagtgaaccgcaactggtactcagatgctgacatgcctgcctcagcccgccaggat
ggctgccaggacatcgccacgcagctcatctccaacatggacattgacgtgatccttggc
ggaggccgcaagtacatgtttcccatggggaccccagaccctgagtacccaggtgatgcc
agccagaatggaatcaggctggacgggaagaacctggtgcaggaatggctggcaaagcac
cagggtgcctggtatgtgtggaaccgcactgagctcgtgcaggcgtccctggacccgtct
gtgacccatctcatgggcctctttgagcccggagacacgaaatatgagatccaccgagac
cccacactggacccctccctgatggagatgacagaggctgccctgcgcctgctgagcagg
aacccccgcggcttcttcctcttcgtggagggcggccgcatcgaccatggtcatcatgag
ggtgtggcttaccaggcactcactgaggcggtcatgttcgacgacgccattgagagggcg
ggccagctcaccagcgaggaggacacactgaccctcgtcaccgctgaccactcccatgtc
ttctcctttggtggctacaccttgcgagggagctccatcttcgggttggcccccagcaag
gctcaggacagcaaagcctacacgtccatcctgtacggcaatggcccgggctacgtgttc
aactcaggcgtgcgaccagacgtgaatgagagcgagagcgggagccccgattaccagcag
caggcggcggtgcccctgtcgtccgagacccacggaggcgaagacgtggcggtgtttgcg
cgcggcccacaggcgcacctggtgcatggtgtgcaggagcagagcttcgtagcgcatgtc
atggccttcgctgcctgtctggagccctacacggcctgcgacctggcgcctcctgcctgc
cccaccgacgccgcgcacccggttgccgcgtcgctgccactgctggccgggaccctgctg
ctgctgggggcgtccgctgctccctga

DBGET integrated database retrieval system