KEGG   Pseudomonas pseudoalcaligenes: BN5_3698Help
Entry
BN5_3698          CDS       T03772                                 

Gene name
tuf1
Definition
(GenBank) Elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
ppse  Pseudomonas pseudoalcaligenes
Brite
Translation factors [BR:ppse03012]
 Eukaryotic Type
  Elongation factors
   BN5_3698 (tuf1)
 Prokaryotic Type
   BN5_3698 (tuf1)
Mitochondrial biogenesis [BR:ppse03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BN5_3698 (tuf1)
Exosome [BR:ppse04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BN5_3698 (tuf1)
  Exosomal proteins of breast cancer cells
   BN5_3698 (tuf1)
  Exosomal proteins of colorectal cancer cells
   BN5_3698 (tuf1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3813747..3814940)
Genome map
AA seq 397 aa AA seqDB search
MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAKVDFDKIDSAPEEKARG
ITINTAHVEYDSNIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSALMALN
GEDTNELGTTAVKKLVETLDTYIPEPVRAIDKPFLMPIEDVFSISGRGTVVTGRVERGIV
RIQEEIEIVGLRPTTKTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDEVERGQVLAKPG
TIKPHTKFEAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGSCELPEGVEMVMPGDNI
KMVVTLIKPIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaggaaaaattcgaacgtaacaaaccgcacgtcaacgttggcaccattggtcac
gttgaccacggtaaaaccactctgaccgctgctctgacccgtgtctgctccgaggttttc
ggttcggccaaggttgacttcgacaagatcgacagcgctccggaagaaaaagctcgtggt
atcaccatcaacaccgcgcacgtagagtacgactccaacattcgtcactacgcgcacgtt
gactgcccgggccacgccgactacgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtctgctcggctgccgacggccccatgccgcaaacccgtgagcacatc
ctgctgtcccgtcaggtaggcgtgccgtacatcgttgtcttcctgaacaaggctgacatg
gttgacgacgctgagctgctggaactggtcgagatggaagttcgcgacctgctgagcacc
tacgacttcccgggtgacgacactccgatcatcatcggctccgcgctgatggctctgaac
ggcgaagacaccaacgagctgggcactaccgctgtcaagaagctggtcgagactctggat
acctacattccggagccggttcgtgccatcgacaagccgttcctgatgccgatcgaagac
gtattctcgatctccggccgcggtactgtagtgaccggtcgtgttgagcgcggtatcgtc
cgtatccaggaagaaatcgaaatcgttggtctgcgtccgaccaccaaaaccacctgcacc
ggcgttgagatgttccgcaagttgctggacgaaggtcgtgctggtgagaactgcggcgtg
ctgctgcgcggcaccaagcgtgatgaggtcgagcgtggtcaggttctggccaagccgggc
accatcaagccgcacaccaagttcgaagcagaagtgtacgtactgtccaaggaagaaggt
ggtcgtcacactccgttcttcaagggctaccgtccgcagttctacttccgtaccactgac
gtgaccggttcgtgcgaactgccggaaggcgttgagatggtaatgccgggcgacaacatc
aagatggttgtcaccctgatcaagccgatcgccatggaagacggcctgcgcttcgcaatt
cgcgaaggcggtcgtaccgttggtgccggcgtggttgccaagatcatcgagtaa

DBGET integrated database retrieval system