KEGG   Pseudomonas psychrotolerans: BJP27_01885Help
Entry
BJP27_01885       CDS       T05074                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ppsl  Pseudomonas psychrotolerans
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ppsl00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BJP27_01885
Enzymes [BR:ppsl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BJP27_01885
Transporters [BR:ppsl02000]
 Other Transporters
  Pores ion channels [TC:1]
   BJP27_01885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(425990..426601)
Genome map
AA seq 203 aa AA seqDB search
MKIYHTPLSGHAHRAVLFASLLGLAPELVEVDLAAGEHRSPAFLALNPFGQVPVLEDDGL
VIADSNAILVYLAKKLGRTDWLPEDAAGAAAVQRWLSVAAGELAYGPAAARLITVFGAPL
DAREVIARAQVLLQRLEGQLATRDWLAADHPTLADVALYSYLAGAPEGNVDLAPYAAVRA
FLQRVEALPGFVPFPQTAAGLRS
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaagatctatcacactccgctgtccggtcatgcccatcgcgccgtgctgttcgcgtcc
ctgctgggccttgcgcccgagctggtggaggtcgatctcgccgccggtgaacaccgctcg
ccggcctttctcgcgctcaacccctttggccaggtgccggtgctggaggacgacggcctg
gtcatcgccgattcgaacgccatcctcgtctacctggcgaagaaactgggccgcaccgat
tggctgccggaagacgccgccggcgccgcggcggtacagcgctggctgtcggtcgccgct
ggcgagctggcctatggtcccgcagcggcgcgcctgatcacggtgttcggcgccccgctc
gatgcccgggaagtcatcgcccgcgcccaggtactgctgcaacgcctggaaggccagttg
gcgacccgcgactggctggccgccgaccatcccaccctggccgacgtggccctctacagc
tatctcgccggagcgccggagggcaacgtcgatctggcgccctatgcggcggtgcgcgcg
ttcctgcaacgggtggaggcgttgccgggcttcgtccccttcccgcagacagccgccggt
ctgcggagctga

DBGET integrated database retrieval system