KEGG   Pseudomonas psychrotolerans: BJP27_06345Help
Entry
BJP27_06345       CDS       T05074                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ppsl  Pseudomonas psychrotolerans
Brite
Enzymes [BR:ppsl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BJP27_06345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: APQ11131
UniProt: A0A147H6Q5
LinkDB All DBs
Position
1425588..1426115
Genome map
AA seq 175 aa AA seqDB search
MKIWTATLLATCLAGTAQAAESLTIPMNKISTDGVGESVGSVQVTRSKYGLVFTPDLKGL
EPGIHGFHVHTKPNCGPAEVDGKATAGGAAGGHLDPRNTGKHSAPWSDDGHLGELPALYV
TADGQATQPVLAPRLKRLEELKGHALMIHAGGDNYADQPKPLGGGGARVVCGVIK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctggaccgcgacgctgttggccacctgcctggcgggcaccgcccaggccgct
gaatccctgaccattcccatgaacaagatctcgaccgacggtgttggcgagagcgtcggc
agcgttcaggtgacccgttccaagtacggcctggtctttacgcccgatctcaagggcctg
gagcccggcatccacggcttccatgtgcataccaagcccaactgcggtccggccgaggtg
gatggcaaggcgaccgctggcggtgctgcagggggtcacctcgatccgcgcaataccggc
aagcacagcgcgccctggtcggatgacggccacctgggtgaattgccggcgctctacgtg
acggccgacggccaggcgacccaaccggtgctggcgccgcgcctcaagcgtctggaagaa
ctcaagggccacgccctgatgatccatgccggtggcgacaactatgccgaccagcccaag
ccactcggcggtggcggtgcccgcgtggtgtgcggcgtcatcaagtag

DBGET integrated database retrieval system