KEGG   Pseudomonas psychrotolerans: BJP27_11430Help
Entry
BJP27_11430       CDS       T05074                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ppsl  Pseudomonas psychrotolerans
Pathway
ppsl00473  D-Alanine metabolism
ppsl00550  Peptidoglycan biosynthesis
ppsl01100  Metabolic pathways
ppsl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppsl00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BJP27_11430
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BJP27_11430
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BJP27_11430
Enzymes [BR:ppsl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BJP27_11430
Peptidoglycan biosynthesis and degradation proteins [BR:ppsl01011]
 Precursor biosynthesis
  Amino acid ligase
   BJP27_11430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp RimK ATPgrasp_YheCD ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: APQ12080
LinkDB All DBs
Position
complement(2556817..2557830)
Genome map
AA seq 337 aa AA seqDB search
MIKDKLKIAVLLGGTSEERDVSIASGAQVVAALRRRGHQVVTVDTALGLLDEDAERALLE
ARVGLEPPERTALVRMRGQDAGAVLSQAQLGDQDLLFLALHGGTGENGTLQTLLDLAELR
YTGSGRVGSAVAMDKDLSKRLFRAAGVPTADWLMAPVAAETVAETLGFPVIVKPSQQGST
VGLSKVSRAEDLQPAIELALRYDREVMIERFVAGRELTVGVLGDQALAVGEIVLGQSGVF
DYTSKYQPQGAVEVFPAEVSAEIAAEARRLALAAHRALKLDGYSRADFRLDAEGRLWCLE
VNTLPGMTATSLLPQSAAAVGIDFDELCERICRLALR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggacaagctgaagatcgccgtcctgctcggcggcaccagcgaggaacgcgat
gtgtccatcgccagcggcgcccaggtggtggcggccctgcgtcggcgcgggcaccaggtg
gtgaccgtggacaccgccctggggctgctcgacgaggacgccgaacgggcgctgctggaa
gcccgggtcggtctcgaaccgccggagcggaccgctctggtgcggatgcgcggccaggac
gccggtgccgtgctcagccaggcgcaactgggcgaccaggatctgctgttcctcgcgctg
cacggcggtaccggtgagaacgggaccttgcagaccctgctcgatctggccgagctgcgc
tataccggtagcggccgcgtaggcagcgccgtggccatggacaaggacctcagcaagcgg
ttgttccgcgccgctggggtgcccaccgccgactggctgatggcgccggtggctgccgaa
accgtggccgagaccctcggtttcccggtgatcgtcaagcccagccagcagggctccacc
gtgggtctgagcaaggtcagccgcgccgaggacctgcagccagccatcgagttggcgctg
cgttacgaccgcgaggtgatgatcgagcgcttcgtcgccggtcgcgagctgaccgtgggg
gtcctgggtgaccaggccctggcggtgggcgagatcgtcctcggccagagcggcgtgttc
gactacaccagcaagtaccagccccaaggcgcggtggaagtgttccccgctgaggtatcg
gccgagatcgccgccgaggcgcgccggctggccctggctgcgcaccgggcgctcaagctc
gatggctacagccgcgccgatttccgcctggatgccgaggggcggctgtggtgcctggag
gtcaataccctgccagggatgaccgccaccagcctgctgccgcaatcggcggcggcggtc
ggcatcgatttcgatgagttgtgcgagcgcatttgccggctggctctgcgatga

DBGET integrated database retrieval system