KEGG   Pseudomonas psychrophila: AOC04_00530Help
Entry
AOC04_00530       CDS       T04081                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
ppsy  Pseudomonas psychrophila
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:ppsy00001]
   00650 Butanoate metabolism
    AOC04_00530
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AOC04_00530
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AOC04_00530
   00430 Taurine and hypotaurine metabolism
    AOC04_00530
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    AOC04_00530
Enzymes [BR:ppsy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AOC04_00530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
111065..112462
Genome map
AA seq 465 aa AA seqDB search
MALHRIKRNKDTDPVFGSSALAHAAAIKLFPESEQAAREVYQLVHDELYLDGNARQNLAT
FCQTWEEDEVHKLMDLSIDKNMIDKDEYPQSAELENRCIHMLADLWHSPAAASTLGTSTV
GSSEACMLSGLAALWRWRAVRKAAGKPTSTPNMVCGPVQVCWHKFARYWDIEIREVPMSE
GHWFMTPEDMLERVDDNTIVVVPTFGQTFTGLYETVLPLSDALDDLEKRTGLSVDIHVDG
ASGAMLAPFCAPDILWDFRVPRVKSISTSGHKFGLAPLGAGWVVWRDAKELPEGLIFHVN
YLGGDMPTFALNFSRPAGQIIAQYYNFLRLGREGYERIHSACYETAQFLARELVKVGPFE
MLYNGDPQLGIPALTWRLKPGAKTNYSLYDLADRLRIRGWLVPAYSLPANVENVVVQRIL
VKQGMSIDMAKLLLADFTRDIQFFDEHQPHGFKGREAEAGNHAGR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcactgcaccgcatcaaacgtaacaaggataccgatccagtctttggctcttcggcc
ctggcccacgctgccgcgatcaagctcttcccggagtccgagcaggcggcgcgggaggtt
taccagctggtccatgacgagttgtatctggacggcaacgcccgccagaacctcgccacc
ttctgccagacctgggaggaagacgaagtccacaagctgatggacttgtccatcgacaag
aacatgatcgacaaggatgagtatccgcagtcggccgagctggagaaccgatgcatccac
atgctggccgacctgtggcattcgcctgctgcggccagcaccctgggcacctcgaccgtc
ggttccagcgaggcctgcatgctcagtggcctggctgcgctgtggcgctggcgtgcagta
cgcaaagccgccggcaagccgacttcaaccccaaatatggtgtgcggcccggtgcaggtc
tgctggcataaattcgcccgttattgggacattgagatccgtgaagtgccgatgtcggaa
ggtcattggtttatgactcccgaagacatgcttgagcgggtcgatgacaataccatcgtg
gtggtcccgaccttcggtcagacctttaccggtctgtacgaaacggtattgccattgtca
gatgctctggatgatctggaaaaacgcaccggcctgagcgttgatattcacgttgacggt
gccagtggcgcgatgctggcgccgttctgtgcccccgatattttgtgggacttccgtgta
ccgcgggtcaagtccatcagcacctccggccacaagttcgggctggccccgctgggcgcg
ggttgggtcgtttggcgcgatgcgaaggaattaccggaaggcctgatttttcacgtcaac
tacctgggtggcgacatgcccactttcgccctgaacttctcccggccggccgggcagatt
attgcccagtactacaacttcttgcgcctggggcgtgagggttatgagcgtattcattcg
gcgtgttacgagacagcgcaatttctggcccgggagctggtcaaggtcggcccgttcgag
atgctctacaacggtgacccgcagttggggattccggccctgacctggcgtttgaagccc
ggtgcaaaaaccaattactcactctacgacctggcagatcgcctgcgcatacgcggttgg
ttggtgccagcctatagcttgcctgccaacgtagaaaacgtcgtggtgcagcggattttg
gtgaagcaggggatgtcgatcgacatggccaaattactgttggccgactttacgcgtgat
attcagttcttcgatgagcatcagccccacggctttaaaggccgtgaggctgaagcaggt
aatcacgccgggcgctaa

DBGET integrated database retrieval system