KEGG   Pseudomonas psychrophila: AOC04_10550Help
Entry
AOC04_10550       CDS       T04081                                 

Definition
(GenBank) non ribosomal peptide synthase
Organism
ppsy  Pseudomonas psychrophila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2406321..2410793)
Genome map
AA seq 1490 aa AA seqDB search
MAIPHQPQPHSLIEMLAQRAEQQGEQLALRFLGDGNQTTELYTYAQLDARVRHLAACLGQ
HAGEGDRVLLLLTNGPDYIVAFFACLYAGLIAVPAYPPERNRQFHTERLQGMAMDAEPSL
ILCEHAALDASRLLRDGLTLAHLPAVASVQDLEAQAPRAWQPRTVPGDAVAMLQYTSGST
SEPKGVEVTHANLLDNQRLLQMGFGTRPGDVFVSWLPLYHDMGLIGGMLQPIYAGVPLVL
LTTQHFLARPARWLQAIHRYGGTLSGGPDFAFRLCTESVRDSLLDELDLSQWRVAFCGSE
PVRADTLADFVERFSPAGLAATTVHPCYGLAEATLMVTSNTRGGPYYTLHVDHDQLALGR
VVADPHGTEMVSSGGLLFDDQVRLMNPQTLQPVAENTVGEIWVRGPSVARGYWRNPEATA
RTFLDLPDGRWLRSGDLAFLHQGGLFITSRAKDVIIIRGQNRYPQDIEKAVEQGVEAVRK
GRVAAFPVQVDGRECIGIAAEIGRSVQKKFDPQVLIEAIDRVVSDTQQEPASVIALLEPA
ALPKTTSGKLQRSACRQRLESGELGAYHVYRRPLLNPRAAGQAGAAPRGHTEQRLAAIWS
EVLEGTEISRDDIFLAVGGHSLAAVQVLARVRSEFNVELPLSALFAASPLALLAASVDAA
PRLAAGVPLQALHASGPQAMSPVQRSLWLAQQLGAEQGGAAYNMVAQLRLCGELRVEALQ
AALTGLLQRQASLRSAFVPGPDGVALVHCAARVELALPVLDLSGLRDAEQATALAVAEAE
AAGQAFDLQRAPLLRATLLRLSDQEYRLLLSMHHLIGDGWSFGVLVQELGAGYQAQLAGS
PSALAPLSIQYSDYAAWQNARSGSAERQREEDFWRNYLQDAPQQLALPTDRARPSTPHTG
GSSVALQLDAEQVGRLEALGRAHGASLFMVLRGAFDWLMHRLTGQDDLIYGTDIAGRPRT
ELEQLIGFFVNIVPLRARVHPQQSFNQWLARVSEDSLRVLEQADLPFEQIVEASGVPRQR
NPLVQALFVLHSMPRGQFAVPGLSAELLGAPAQTSKFDMALFLTPNACGLGGEWVFATSI
LDEARVRCWAEAWVDLLGQILADPDRPLDALTLAALQPTPVAPVSGRSRLDAKRDKLKSF
TRPATSPVAMAAVRCRPLNVGSELPLVIEPVSADLDPCVWASQNREFIETSLRRHAGLLF
RGFGLSTAQDFEAFAEAIQPGLYGAYGDLPKKEGGRNTYRSTPYPERQMILFHNESAHLR
RWPRKQWFFCEQPSPVGGATPIVDCRAMYRALPASLAETFERKGLLYVRTFTPGFDVDWR
DFYKTDQRAVVEAACREQGVAFEWLANGGLQTRTPCPAVIRHPYTGEKSFFNQVQLHHDY
CLQADVRRDLLGIVGAGFMPRQVYFGDGTPIDDVVMEQLGQLYETCAVRFDWQRGDVVML
DNMLVAHARDPFEGPRRIVVAMGEMTDRSVFDGAAQDNPERSGQSAGLPV
NT seq 4473 nt NT seq  +upstreamnt  +downstreamnt
atggccatcccacatcagcctcaaccccactccctgatcgagatgctggcgcagcgcgcc
gagcagcaaggcgaacaactggccttgcgctttctcggtgacggcaaccagaccaccgag
ctgtacacctacgcgcaactggatgcccgggtccggcacctggctgcctgtctggggcag
cacgccggggagggcgaccgggtgctcctgctgctgaccaacggccccgactacatcgtg
gcctttttcgcgtgcctgtatgccggtctgattgcagtgccggcctatccgccggaacgc
aaccgccagttccataccgaacgcctgcaaggcatggccatggatgccgagccgtcgttg
atcctctgcgagcatgcggccctcgacgcttcccggttgctgcgcgatggcctgaccctg
gcgcacctgccggccgtggccagcgtccaggaccttgaggcgcaagcgccccgggcctgg
caaccgcgtacggtgccgggcgatgccgtcgccatgctgcaatacacctccggctccacc
tccgaacccaagggcgtcgaagtcacccacgccaacttgctggacaatcagcgcctgctg
caaatgggcttcggcacccgccccggggatgtatttgtcagctggctgccgctgtaccac
gacatgggcctgatcggcggcatgctgcagccgatctatgccggtgtgccgctggtgttg
ttgaccacccagcacttcctcgcccggccggcgcgctggctccaagcgattcaccgctac
ggcggtaccctcagcggcggccccgactttgccttccgcctgtgtaccgagagcgtgcgc
gacagcctgcttgacgagctcgacctgagccagtggcgcgttgcgttttgcggttccgaa
ccggtacgggccgacaccctggccgacttcgttgagcgcttctccccggcaggactggcg
gcgaccaccgtgcacccgtgctacggcctggccgaagcgaccctgatggtcaccagcaac
acccgtggcggcccgtactacaccctgcatgtggaccacgaccaattggccctgggccgg
gtggttgccgatccgcacggcaccgaaatggtcagcagcggcggtttgctgttcgacgat
caggtgcgcctgatgaacccgcagaccttgcagccggtggctgaaaacaccgtgggtgaa
atctgggtccgcggccccagcgtggcccgtggctactggcgcaaccccgaggccaccgcc
aggactttcctcgacctgcccgacggccgctggctgcgcagcggtgacctggcgttcctg
catcagggcggtctgttcatcacctcgcgggccaaggacgtgatcatcattcgcggccag
aaccgttacccgcaagacatcgaaaaagctgtggagcagggcgtcgaagcggtgcgcaag
gggcgtgtcgcggcgttcccggtgcaggtcgacggtcgcgagtgcatcggcatcgccgcc
gagatcgggcgcagtgtgcaaaagaaattcgacccccaagtgttgatcgaagccatcgac
cgggtggtcagtgacacccagcaggaaccggccagcgtcatcgccctgctcgaaccggcc
gccttgcccaagaccaccagcggcaagctgcagcgctcggcctgccgccagcgtctggag
agcggtgaactgggggcttaccacgtctatcgtcgaccgctgttaaacccgcgtgcagcc
gggcaggccggtgccgcaccccggggccataccgaacagcgtctggcggcgatctggtcc
gaggtgcttgaaggcaccgagatcagccgcgacgacatctttctcgcggtgggcggtcac
tccctcgccgccgtgcaagtactggcgcgagtgcgcagcgaattcaacgtcgaattgccg
ttgagcgcgctgttcgccgccagccccctggccctgctggccgcctcggttgacgccgca
ccacgtctggccgccggggtgccattgcaggcactgcacgccagcgggccgcaggccatg
tcgccggtacaacgcagcctgtggctggcgcagcagttgggtgcagaacagggtggcgcg
gcctacaacatggttgcccagttgcgcttgtgtggcgagctgcgggtggaggccctgcaa
gcggcactgacgggtttgctgcagcgtcaggcgagtttgcgcagtgctttcgtgccgggc
ccggatggcgtggctctggtgcactgtgccgcccgggtggaactggccttgccggtgctc
gacctcagtggcctgcgcgatgccgaacaggccactgcgctggcggtggccgaggccgaa
gcggcggggcaggcgttcgacctgcagcgggcgccgctcctgcgcgccacgctgctgcgc
ctgagcgaccaggaatatcgactgctgttgagcatgcatcacctgatcggcgatggctgg
tcgtttggcgtgctggtccaggaactgggtgcgggctaccaggcgcaactggcgggcagc
ccgtcggcgctggcaccgttgagcattcaatacagcgactacgcggcctggcagaacgcc
cggtccggcagtgccgagcgccagcgcgaggaggatttttggcgcaactatctgcaagac
gcaccgcagcaactggccttgcccactgatcgtgcgcgtccatcgaccccgcacacaggg
ggctccagcgtggccttgcagctcgacgccgagcaggtcgggcgtctcgaagccctgggc
cgtgcccacggcgccagcctgttcatggtcctgcgcggtgctttcgactggctgatgcat
cgcctcaccggccaggacgatttgatttatggcaccgatatcgccggtcgaccgcgaacc
gagctggaacaactgatcggcttcttcgtcaacatcgtgccgctgcgcgcccgggtacac
ccccagcaatcgttcaaccagtggctggcccgggtcagcgaggattcattgagggtcctc
gagcaggcggacttgcccttcgaacagatcgtcgaggccagcggtgtgccccgccagcgc
aacccgttggtgcaggcgctgttcgtgttgcacagcatgccccgcgggcagttcgcggtg
ccggggctgagcgccgaactgctcggcgcgccagcgcaaacctcaaaattcgacatggcc
ctgttcctgacgcccaatgcctgtggcctgggcggcgagtgggtgttcgccacgtcgatc
cttgacgaggcgcgggtgcgttgctgggccgaggcctgggtcgacctgctcgggcaaatc
ctcgccgatcccgatcgccccctggacgcattgaccctcgctgccttgcagcccacgccc
gtcgccccggtcagcgggcgctcgcggctggatgccaaacgcgacaagctgaagtccttc
acccgcccggcaacgtcgccggtggcgatggctgccgtgcgctgcaggccgctcaatgtg
ggtagcgagttgccgctggtgattgagccggtcagtgccgatctcgacccctgcgtgtgg
gccagccagaaccgcgagttcattgaaaccagcctgcgccgccatgccggcctgctgttc
cgtggcttcggcctgagcaccgcgcaagacttcgaagctttcgccgaggccatccagccg
ggcctgtatggcgcctatggcgacttgccgaagaaagagggcgggcgcaacacctaccgc
tccacgccataccccgagcggcagatgatcctgttccacaacgaaagcgcgcacctgcgg
cgctggccgcgcaagcagtggttcttctgtgagcagccgtcgccggtcggcggtgccacg
cccatcgtcgattgccgggcgatgtaccgcgcgttgccggccagtctggccgagaccttc
gagcgtaaggggctgttgtatgtgcgcaccttcaccccgggcttcgatgtggactggcgt
gatttctacaagaccgaccagcgtgccgtggtcgaggcggcctgccgcgagcagggcgtg
gcgttcgaatggctggccaatggcggcctgcaaacccgtaccccttgtccggcagtgatc
cgccacccctacaccggggaaaagtcatttttcaaccaggttcaactgcaccacgactat
tgcctgcaagccgatgtgcgccgcgacctgctgggcatcgtcggggccgggttcatgccg
cgccaggtgtatttcggtgatggcacgcccatcgacgacgtggtcatggaacaactgggt
cagctctatgaaacctgcgcggtgcgcttcgactggcagcgtggcgacgtggtgatgctc
gacaacatgctggtggcccacgcccgcgatccgttcgaaggcccgcggcggatcgtcgtg
gccatgggcgaaatgaccgaccgtagcgtgttcgatggcgctgcccaagacaacccagag
cgctcgggccaatcggccgggctgcctgtttaa

DBGET integrated database retrieval system