KEGG   Pseudomonas putida KT2440: PP_0440Help
Entry
PP_0440           CDS       T00114                                 

Gene name
tufA
Definition
(RefSeq) elongation factor Tu-A
  KO
K02358  
elongation factor Tu
Organism
ppu  Pseudomonas putida KT2440
Brite
Translation factors [BR:ppu03012]
 Eukaryotic Type
  Elongation factors
   PP_0440 (tufA)
 Prokaryotic Type
   PP_0440 (tufA)
Mitochondrial biogenesis [BR:ppu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PP_0440 (tufA)
Exosome [BR:ppu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PP_0440 (tufA)
  Exosomal proteins of breast cancer cells
   PP_0440 (tufA)
  Exosomal proteins of colorectal cancer cells
   PP_0440 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
532736..533929
Genome map
AA seq 397 aa AA seqDB search
MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAIVEFDKIDSAPEEKARG
ITINTAHVEYNSTIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADLVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSARMALE
GKDDNEMGTTAVKKLVETLDSYIPEPVRAIDQPFLMPIEDVFSISGRGTVVTGRIERGIV
RVQDPLEIVGLRDTTTTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDDVERGQVLVKPG
SVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
QMTVTLIKTIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaaaagtttgatcgttcccttccccacgttaacgtcggcactatcggccac
gttgaccacggtaagaccactctgaccgcagctctgactcgcgtttgctccgaagttttc
ggttcggcaatcgttgagttcgacaagatcgactcggctccggaagaaaaagcgcgcggt
atcaccatcaacaccgctcacgtcgagtacaactcgaccattcgtcactacgctcacgtt
gactgcccaggtcacgctgactacgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtttgctcggccgccgatggtccgatgccacaaacccgtgagcacatc
ctgttgtcccgtcaggtaggcgttccgtacatcgtggtcttcctgaacaaggctgacctg
gtagacgacgctgagctgctggagctggtcgagatggaagttcgcgacctgctgtccacc
tacgacttcccaggcgacgacactccgatcatcatcggttccgctcgtatggcgctggaa
ggcaaagacgacaacgaaatgggcactaccgctgttaagaagctggtagaaactctggac
agctacattcctgagccagttcgtgctatcgaccagccgttcctgatgccgatcgaagac
gtgttctcgatctcgggtcgtggtaccgttgttaccggtcgtatcgagcgtggcatcgtc
cgcgttcaggatccgctggaaatcgttggtctgcgtgacaccaccaccaccacctgcacc
ggtgttgagatgttccgcaagctgctggacgaaggtcgtgctggcgagaactgcggcgtt
ctgctgcgtggtaccaagcgtgacgacgttgagcgtggccaggttctggtcaagccaggt
tcggtcaagccgcacaccaagttcaccgcagaagtctacgtcctgtcgaaggaagaaggc
ggccgtcacactccgttcttcaaaggctaccgtccacagttctacttccgtaccactgac
gtgaccggtaactgcgaactgccggaaggcgttgaaatggtaatgccaggtgacaacatt
cagatgactgttaccctgatcaagaccatcgcaatggaagacggtctgcgcttcgctatc
cgtgaaggcggtcgtaccgtcggcgccggcgtcgtagcaaaaattattgaataa

DBGET integrated database retrieval system