KEGG   Pseudomonas putida KT2440: PP_4243Help
Entry
PP_4243           CDS       T00114                                 

Gene name
pvdL
Definition
(RefSeq) non-ribosomal peptide synthetase
Organism
ppu  Pseudomonas putida KT2440
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4818236..4831189)
Genome map
AA seq 4317 aa AA seqDB search
MTDAFELPLSLVQALAQRAAQTPERIALRFLADTPGEQAVLSYRDLDQRARTIAAALQGR
ASFGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESARQQHQERLLSIIDDAEPRLL
LTVAALRDSLQGLEALAADNAPQLLAVDGLDPALAANWREPVLKGDDIAFLQYTSGSTAL
PKGVQVSHGNLVANEQLIRQGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVL
MSPRYFLARPLRWLQAISEYGGTISGGPDFAYRLCSERVSEASLAGLDLSRWRVAYSGSE
PIRQDSLATFADKFQACGFDPQSFFASYGLAEATLFVSGSRRGQGIAALELDAKAFAANR
AEPGTGSVLMSCGFPQPGHAVRIVEPQQLQVLGDNQVGEIWAGGPSIARGYWRNPEASAR
TFVEMDGQTWLRTGDLGFIREGEVFVTGRLKDMLIVRGQNLYPQDLEKALEREVQVLRKG
RVAVFAVEHQGEEGIGVAVEISRNVQKALKPQDLIKTLRQVVADACRQAPAVVLLLNPGA
LPKTSSGKLQRSACRLRMDDGSLDCYARFPEVSAAGIRATAGDELQARIAAVWRDILKVE
AVAADDHFLLLGGNSIAATQATARLADELGIDLSLRTLFEAPVLADYSKAVAQIIADGAA
ATTAITTLERAQALPQSLAQNRLWLLWQLEPQSAAYNIPAGLHLRGELDVNALHVAFQAL
VARHESLRTVFSEENGQALQRILPQQPLSLHRLDLEGHSPEQVAAQRETEARQPFDLTQG
PLLRVTLVRLGDEEHQLWVTLHHIVADGWSLNILLEEFAKLYAARCQGLEANLAPLPLGY
ADYGSWQRQWLADGEAERQLQYWKAHLGGELPALDLCTDHPRASQREHSAARFSLKVPVR
LGEALKGLAHQQQASLFMVLLAGWQALLQRYSGQADIRVGVPNANRPRLETQGMVGFFIN
TQVLRARFDGRHSFTQLLTQVRQATLQAQANQDLPFEQLVEALPDAREQGLFQVMFNHQQ
RDLSALRRLPGLLAEELAWHSREAKFDLQLHSEEDHLGRLSLAFDYAAELFEASTVERLA
HHLLALLEQVCAAPQQALGDVQLLDEPGRAQLLGWGQAPAAAAQHLLVEQLNEQVRLTPQ
RTALVWDGGSLDYAGLHQQANRLAHYLRDKGVGPDTCVAIAIERSPQLLVGLLAILKAGG
AYVPLDVDYPAERLAYMLADCDARLLLSHSSLLGKLPQVDGVSAIALDQLHLDSWPSHAP
GLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQTTYALNDSDVLMQKAPISFD
VSVWECFWPLVTGCKLVLAGPGEHRDPQRIAALVQAYGVTTLHFVPPLLQVFVQEPQASA
CSSLRWVFSGGEALSATLRDRVLQVLPQVQLHNRYGPTETAINVTHWHCQVVDGERSPIG
RPLGNVLCRVLDDELELSAPGVPGELYLGGAGLARGYLGRPGLTAERFVPQADGNGQRLY
RSGDRARWQVQLEALEYLGRLDQQVKVRGFRVEPEEVQACLLAQAGVEQALVLIHKDAIG
AQLVGYYSGSAQPAEVLAVLAEQLPAYMVPAQLIPLAQMPLGPSGKVDRKALPAPVWQQR
EHVEPRTELQQQVAAIWRDVLNLPRIGLQDDFFALGGHSLLATQIVSRTRQACDVELPLK
ALFEASELGAFCAEIARLRAAGERNLQGAITRVDRRQAVPLSYSQQRMWFLWQMEPDSPA
YNVGGMARLRGTLHVDAFERALQALIVRHETLRTTFPSIDGVPYQCVAEDSGLHLDWQDF
SALSDDACQQRLQQLADDQAHQPFDLERGPLLRACLVKANEREHFFVLTLHHIVTEGWAM
DIFARELGELYEAFVDDRESPLAPLPVQYLDYSVWQRQWLESGEGARQLAYWKHRLGDEH
PVLALPADRPRPAVQSHRGELYRFELDPALVARVHAFNSQRGLTLFMTMTATLAALLHRY
SGQRDLRIGAPVANRIRPESEGLIGAFLNTQVLRCELDGQMTASALLEQVRQAAIEGQSH
QDLPFDQLVEALQPPRSSAYNPLFQVMCNVQRWAFQQSRTLAGMQVDYLVNDASATKFDL
YLEVTDLDGRLGCCLTYSRDLFDAPRIARMAEHWQQLLVGLLDNPQHRLCELPMLSSAEQ
QVLTGQLQGEHDFDLGQTLHGLFAAQAARTPQAGALTFAGQHLTYAELDQQANRLARALR
ERGVGPQVRVGLALERSLEMVVGLLAILKADGAYVPLDPEYPLDRLRYMIEDSRIGLLLS
QRALLHTLGELPEGVASWSLEDDAASLAAYSDAPLDNLSLPQHQAYLIYTSGSTGKPKGV
VVSHGEFAMHCQAVIAAFGMRSDDCELHFYSINFDAASERLWVPLLCGARVVLRAQGQWG
AEDICQLVREQQVSILGFTPSYGSQLAQYLGGRGEQLPVRLVITGGEALTGEHLQRIRQA
FAPQQCFNAYGPTETVVMPLACLAPEALPADLGSVPIGRVIGSRTAYILDEDLALLPQGG
IGELYVGGAGLAQGYHDRPGLTAERFVADPFSAEGGRLYRTGDLVRLGTDGLVEYVGRAD
QQVKIRGFRIELGEIESRLLAHEDVDEAVVLALDLPGGKQLVGYLVCRQATAGNDVQQLL
REAVKADARQHLPDYMVPAHLVLLDSLPLMGNGKLDRHALPLPDLEQARQQYQAPGNEVE
AQLAQIWRDVLNVARVGVQDNFFELGGDSILSIQVVSRARQAGLQFTPRDLFQHQTIQTL
ATVVQLSEAASTVEQGLRQGQAGLTPIQHWFFDSDVPQPQHWNQTVLLEVRQPLVEATLE
QALAALVQHHDSLRLRFSDAQGRWQAQYVQPGAEQLLWSATVADFNDCQALYTDVQRSLD
LQQGPLLRALLVRDGQGTQRLLLAIHHLVVDGVSWRVLLEDLQALYRGQPLPAKTHAVGD
WAARLASYAGSDSLRDELAWWQGQLGGVRRELPCDHPQGSNLHRHAQTLAIGLDVEQTRQ
LLQLAPAAYHTQVNDLLLTALARALCRWSGDEEVLVQLEGHGRDGLFEDMDLTRSVGWFT
NAYPLSLRPLPGEDDAARAGSIKRIKEQLRHVPHKGLGYGVLRYLADAAGREQMAALPQA
RITFNYLGQFDQQFDSAALFQPLEASAGLAHDLDAPLPNWLSVDGQVYGGALQLRWTFSA
ERYDQQTIARLAEGYRQELLALVAHCLADGNGSFTPSDFPLAHLTQEQIDALPVPAAQIE
DVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSALDPERFAQAWQAVVARHEALRASF
SWNSGEAMLQIIHKPGNLAVDYQDWRGLADDAQEQRLQALHKQEREAGFALLSEAPFHLR
LVRVAEERYWFMMSNHHILIDAWCRSLLMNDFFEVYQALGEGRQAQLPVPPRYRDYIGWL
QRQGLDDARAWWQANLAGFERATAIPSDRPLRHDHAGSGMVVGDCYTRLEMNDGVRLREL
AQAHQLTVNTFAQAAWALVLSRYSGDRDVAFGVTVAGRPVSMPQMQRTVGLFINSVALRV
QLPAASERCSVRQWLQGLLQSNMELREYEYLPLVAIQACSELPKGQPLFDSLFVFENAPV
ETAVLNHAQHLNASSDSGRTHTNFPLTAVCYPGDDLGLHLSFDQRYFDYPTVERLLAEFK
RLLLALVQGFEGEVSELPLLSAQEQGFLLEDCNRTERVYPLEQSYIAQFEAQVVAHPQRT
VARCLEASYDYAGLNLAANRLGHALVAAGVCVDQPVALLAERGLPLLGMIVGSFKAGAGY
LPLDPGLPAARLQSIIQLSRTPVLVCSAACAEQGRQLLGELEASLRPQLLVWEDVQANPI
ASHNPGIHSGPDNLAYVIYTSGSTGLPKGVMVEQRGMLNNQLSKVPYLALSEQDVIAQTA
SQSFDISVWQFLAAPLFGAKVEIVPNVIAHDPQGLLAHVQATGITVLESVPSLIQGMLAS
DHQALDGLRWMLPTGEVMPPELAAQWLQRYPQIGLVNAYGPAECSDDVAFFRVDAASTQG
SYLPIGTPTDNNRLYLFGEDQALVPLGAVGELCVAGAGVGRGYVGDPVRTALAFIPHPYG
APGERLYRTGDLARQRLDGVLEYVGRIDHQVKIRGYRIELGEIEARLHEQAEIRDAAVAV
QEGVNGKHLVGYLVAHQGVSADAALLEQVKQRLRAELPEYMVPLHWGWFDSLPHNANGKL
DRKALPAIDIGGQYSQAYLAPRNELEDVLAGIWADVLKAERVGVHDNFFELGGHSLLATQ
IASRVQKQLQLNVPLRAMFECSTVEALAEYVQGLQGSALDDDKVDRLSDLMAELEGL
NT seq 12954 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgccttcgaactcccgctctcgctggtccaggccctggcgcaacgcgccgcg
cagaccccggaaaggattgccctgcgctttctcgccgacacacccggtgagcaggccgtg
ctcagctaccgggacctcgaccagcgtgcacgcaccatcgccgccgccttgcaggggcgc
gccagcttcggtgaccgtgccgtgctgttgttccccagcgggccagattacgtggcggcg
ttcttcggctgcctgtatgcgggcgtgatcgcggtgccggcctacccgccggagtccgcg
cgccagcagcaccaggagcgtttgctgtcgatcatcgatgacgccgagccgcgactgctg
ctgaccgtggcggcgctgcgcgacagcctgcagggcctggaagccctggcggcggacaac
gccccccaactgctggcagtggatggcttggacccggccctggctgcgaactggcgtgaa
cccgtgctcaagggcgatgacatcgccttcctgcagtacacctccggttccaccgcgctg
cccaagggcgtgcaggtcagccatggcaacctggtggccaacgagcaactgatccgccaa
ggctttggcatcgacctcaaccccgacgatgtgatcgtcagctggctaccgctgtaccat
gacatgggcctgatcggcggcctgctgcagccgatcttcagtggcgtgccttgcgtgctg
atgtcgccgaggtacttcctggcccggccgttgcgctggttgcaggccatcagcgaatac
ggtggcaccatcagcggtggccccgacttcgcttatcgcctgtgcagcgagcgggtcagc
gaggcttcgctggccgggctcgacctgagccgctggcgcgtggcctattccggctccgag
cctatccgccaggacagcctggccacctttgccgacaagttccaggcctgtggcttcgac
ccgcagagcttcttcgccagttatggcctggccgaagccaccctgttcgttagcggcagc
cgtcgtggccagggtatcgccgcgcttgagctggatgccaaagccttcgccgccaaccgc
gccgaacccggcactggcagcgtgctgatgagttgcggcttcccgcagccggggcacgcg
gtacgcatcgtcgagccgcaacagttgcaagtgctgggcgacaaccaggtgggggaaatc
tgggcaggcggcccgagcatcgcccggggctactggcgcaacccagaagccagcgctcga
accttcgtcgaaatggacggccagacctggctgcgtaccggcgacctgggtttcattcgt
gagggcgaggtgttcgttaccgggcgcctgaaagacatgctgatcgtgcgcggacagaac
ctgtacccgcaggacttggaaaaagccctcgagcgtgaagtccaggtgctgcgcaaaggc
cgtgtggcggtgttcgccgtcgagcaccagggcgaggagggcatcggtgtcgcggtggag
atcagccgcaacgtgcaaaaggcactcaagccccaggacctgatcaagaccctgcgccag
gtcgtcgccgacgcctgccgacaggccccggccgtggtcctgctgctgaaccccggcgcg
ctgccaaagacctccagcggcaagttgcagcgctctgcctgccggctgcgcatggacgat
ggcagcctggactgctatgcccgtttccctgaggtgagcgcagccggtatccgtgcaacc
gctggcgacgagctgcaagcacgcatcgccgctgtgtggcgcgacatcctcaaggtagag
gcggtggccgcggacgaccacttcctgctgctgggcggtaactccatcgccgccacccag
gccacagcgcgcctggccgatgagttgggtatcgacctgagcctgcgtaccctgttcgag
gcgccggtactggccgactacagcaaggctgtggcacagatcatcgccgatggcgctgca
gccaccacggccatcaccacgctggagcgcgcccaggcgttgccccagtcgctggcgcaa
aaccgcttgtggctgctgtggcagctggaaccgcaatcagcggcctacaacattcctgcc
ggcttgcacctgcgtggcgagctggatgtcaacgctctgcacgtggccttccaggcactg
gtggcgcgccatgaatcgctgcgtaccgtgttcagcgaagagaatggccaggcgctgcag
cgtatcctgccgcagcagccgctcagcctgcaccgcctggaccttgaagggcactcgccc
gagcaggttgccgcgcagcgtgaaaccgaggcccgccagccgttcgacctcacccagggg
ccgctgttgcgggtaaccctggtgcgcctgggggacgaagagcatcagctgtgggtgacc
ctgcaccacatcgttgccgacggctggtcgctgaacatcctgctcgaagaattcgccaag
ctgtatgccgctcgctgccaaggcctggaggccaacctggcgccgctgccgctgggttac
gccgactacggcagctggcagcggcaatggctggctgacggtgaagccgagcgccagttg
cagtactggaaggcacaccttggtggtgagctgccggcgctcgacctgtgcactgaccac
ccgcgcgccagccagcgcgaacacagcgccgcgcgcttcagcctcaaggtgccagtcagg
cttggcgaagcgctcaagggccttgcccaccagcagcaggccagcctgttcatggtcctg
ctggccggttggcaggcgctgctgcagcgctacagtggccaggccgatatccgcgtcggc
gtgcccaacgccaaccgcccgcgcctggaaacccaaggcatggtcggtttcttcatcaat
acgcaggtgctgcgcgcgcgattcgatggccgtcactcgtttacccagttgctgacccag
gtacgtcaggccaccttgcaagcccaggctaatcaggacttgcccttcgaacagcttgtc
gaagccctgcccgatgcgcgcgaacagggcctgttccaggtcatgttcaaccaccagcaa
cgcgacctgtcagccctgcggcgcctgccagggctgttggccgaagagctggcgtggcac
agccgcgaagccaagttcgacttgcagttgcacagtgaggaggaccatctgggccgcctg
agcctggccttcgactatgccgcggagctgttcgaagccagcaccgtcgaacgtctggcc
catcacctgctggcgctgctggaacaggtgtgtgccgcgccgcagcaggcgctgggcgac
gtgcaattgctggatgagcccggccgtgcgcagctgctgggttggggccaggcaccggcc
gccgcagcgcagcacctgttggtcgaacaactcaatgagcaggtacgcctgacgccgcag
cgcaccgccctggtttgggacgggggcagcctggattacgccgggctgcaccagcaagcc
aaccgcctggcccactacctgcgtgacaaaggcgtcggccccgatacctgtgtggccatt
gccatcgagcgctcaccgcaattgctggtcggcctgctagccattctcaaggccggcggt
gcctacgtgccgctggatgtcgattaccctgccgaacgcctggcctacatgctggccgac
tgcgacgcccgtttgctactgagccacagcagcctgctgggcaagctgccgcaggtcgac
ggtgtcagcgccattgccctcgaccagttgcacctggacagctggcccagccatgccccc
ggcctgcacctgcacggcgataacctggcctacgttatctatacctccggctccaccggg
cagcccaagggcgtaggcaatacccatgcggcgttggccgagcgcctgcagtggatgcag
acgacctatgcgctgaatgacagcgacgtgctgatgcagaaagcgccgatcagtttcgac
gtctcggtgtgggaatgcttctggccgctggtcaccggctgcaagctggtgctcgccggc
cctggtgaacatcgcgacccgcagcgtatcgctgccctggtgcaggcttatggggtgact
acgctgcactttgtaccgccgctgttgcaggtgttcgtccaggagccgcaggcaagtgcc
tgcagtagcttgcgctgggtgttctcgggtggcgaagcgttgtccgccacgctgcgtgac
cgcgtgctgcaggtgctgccgcaggtgcaactgcacaaccggtatggcccgactgaaacc
gccatcaacgtcacccactggcactgtcaggtggtggacggcgagcgctcgcccatcggc
cgcccgctgggcaatgtgctgtgccgcgtgctggacgatgagctggaactgagcgccccc
ggtgtgccgggcgaactgtacctcggtggcgcgggcctggcccgtggttacttgggccgc
cccggcctcactgccgagcgcttcgtaccccaggccgacggcaatggtcagcgtctgtac
cgcagtggcgatcgcgcccgctggcaggttcagctggaggccctggaataccttggccgc
ctcgaccagcaggtcaaggtgcgcggtttccgcgtcgagcccgaggaagtgcaggcctgc
ctgctggcacaggcgggtgtggaacaggcgctggtgctgatacacaaggacgccattggc
gcgcaactggtcggctattacagtggcagcgcccagcctgccgaggtgctggccgtactg
gctgagcaattgccagcctacatggtgccggcgcaactcatccctttggcacagatgcca
ttgggccccagcggcaaggtcgaccgcaaggcactgcctgccccagtgtggcagcagcgt
gagcatgtcgagccacgaaccgagctgcaacaacaggtcgcggccatctggcgcgacgtg
ttgaatctgccgcgcattggcctgcaggacgacttcttcgccctcggtggtcactcgttg
ctggctacccagatcgtttcgcgcacccgccaggcctgcgatgtcgagctgccgctcaag
gccctgttcgaagccagcgagctgggcgccttctgtgccgagatcgcccgcctgcgcgcg
gccggcgagcgcaacctgcaaggtgcaatcacccgtgtcgaccgccgtcaggcagtgccg
ctgtcgtactcgcagcagcgaatgtggttcctctggcagatggagccggacagcccggcg
tacaacgtcggcggcatggcacgcctgcgcggcaccctgcacgtggacgccttcgagcgt
gcgctgcaggcgctgatcgtgcgccacgaaaccttgcgcaccacgttccccagcatcgac
ggcgtgccgtaccagtgcgtggccgaagacagcggcctgcatctggactggcaagacttc
agcgctttgtcagacgatgcctgccagcaacgtttgcaacaactggccgacgaccaggcg
caccagcccttcgacctggagcgggggccgctgctgcgcgcctgcctggtcaaggccaac
gagcgcgagcacttcttcgtgctgacgctgcatcacatcgtcaccgaaggctgggccatg
gacatcttcgcccgcgaactgggcgagctgtacgaagcctttgtcgatgaccgcgagtcg
ccactggcgccgctgccggtgcagtacctggactacagcgtgtggcaacggcaatggctg
gaaagcggcgagggcgctcgacaactggcctactggaagcaccgcctgggcgacgagcac
ccggtgctggcgttgcctgccgaccgcccgcgtccggcagtccagagccaccgtggcgag
ctgtaccgcttcgaactcgatccggcactggtggcccgtgtgcatgctttcaatagccag
cgcggcctgaccctgttcatgaccatgaccgccaccctggccgccttgctgcaccgttac
agtggccagcgcgacctgcgtatcggcgcgccggtggccaaccgcatccgcccggaaagc
gaaggcctgatcggcgctttcctcaacacccaggtgctgcgctgcgagctggacggccag
atgaccgccagcgcgctgctggagcaggttcgccaggctgccatcgaaggccagtcgcac
caggacctgccgttcgaccaactggtagaggccctgcagcccccacgcagcagtgcctac
aacccgctgttccaggtgatgtgcaacgtgcagcgctgggccttccagcaaagccgcacg
ctggccggcatgcaggtggactacctggtcaacgatgccagcgccaccaagttcgacctg
tacctggaggtgaccgacctggacggccggctgggctgctgcctgacctacagtcgcgac
ctgttcgacgcgccgcgcatcgcgcgcatggccgagcactggcaacaactgctggtcggt
ttgctcgacaacccgcaacaccgcctgtgcgaactgccaatgctgagcagtgccgagcaa
caagtgcttacaggccagttgcagggcgaacacgatttcgaccttggccagaccctccat
ggtctgttcgccgcccaggccgcgcgcacgccacaggctggcgcgctgaccttcgccggc
cagcacttgacctacgccgagctcgaccagcaggccaaccgcctggcgcgtgccctgcgc
gaacggggtgtcggcccgcaggtgcgcgtgggcctggcgctggagcgctcgctggaaatg
gtcgtcggcctgctggccatcctcaaggccgacggcgcctatgtaccgctcgaccccgag
tacccgctcgaccgcctgcgctacatgatcgaagacagccgcatcggcttgctgctcagc
cagcgtgcgctgctgcacaccctgggcgagctgcctgaaggcgtggccagctggagcctg
gaagacgatgccgccagcctggcggcctacagcgatgcaccgctggacaacctcagcctg
ccgcagcaccaggcttacctgatctacacctcaggctccaccggcaaacccaagggcgtg
gtggtcagccatggcgagttcgccatgcactgccaggcggtgatcgccgcattcggcatg
cgcagcgatgattgcgagctgcatttctattcgatcaatttcgacgctgccagcgagcgc
ctgtgggtgccgctgttgtgtggtgcgcgcgtggtactgcgcgcccagggtcagtggggc
gccgaggacatctgccagttggtgcgcgagcagcaggtgagcattctgggcttcaccccc
agctacggcagccagctggcgcagtatctgggcgggcggggcgaacaattgccggtacgc
ctggtgattaccggtggcgaggcgctgaccggcgagcacttgcagcgcatccgccaggcc
tttgcgccgcagcagtgcttcaatgcctacggcccgaccgaaaccgtggtcatgccgctg
gcgtgcctggccccagaggccttgccagcagaccttggcagcgtaccgatcggccgcgtc
atcggtagccgtacggcctacatcctcgacgaggatctggccttgttgccgcaaggcggt
attggcgaactgtacgtcggcggtgccggcctggcccagggttaccacgaccggccaggc
ctcactgccgagcgctttgtcgccgacccgttcagtgccgaaggcgggcgcctgtaccgt
accggcgacctggtacgcctgggtaccgatggcctggtggagtatgtcggccgtgccgac
cagcaggtgaagatccgcggcttccgcatcgaactgggcgaaatcgagagccgcctgcta
gcgcacgaggatgtcgacgaggccgtcgtgctggcgctggacttgccgggcggcaagcag
ctggtgggctatctggtgtgcaggcaggccaccgccggtaacgacgtgcaacaactgctg
cgcgaagcggtgaaagccgatgcccgccagcacctgcccgactacatggtgcctgcgcat
ctggtgctgctcgacagcctgccgctgatgggcaacggcaagctcgaccgccatgcgctg
ccgctgccggaccttgagcaggcgcggcagcaataccaggcccctggcaatgaggtggaa
gcacagctggcgcagatctggcgcgatgtgctcaacgttgcccgggtcggcgtgcaggac
aacttcttcgagctggggggcgactcgatcctgtcgattcaggtggtcagccgcgcccgc
caggccggcttgcaattcaccccgcgcgacctgttccagcatcagaccatccagaccctg
gcaactgtggttcagctcagcgaagccgcgagcacggtggagcagggtctgcgccagggc
caggccgggttgacgccgatccagcactggttcttcgacagtgacgtgccacagccgcaa
cactggaaccagaccgtgctgctggaggtgcgccaacccttggttgaggccacccttgaa
caggcattggctgcgctggtgcagcaccatgacagcctgcgcctgcgcttcagcgacgcc
cagggccgctggcaggcccagtacgtgcagcctggcgccgagcaactgctgtggagcgcc
actgtcgccgatttcaatgattgtcaggcactctacaccgacgtgcagcgcagcctggac
ctgcaacaggggccgctgctgcgcgccttgctggtgcgtgacgggcagggcacccagcgg
ttgctgctggcgattcatcacctggttgttgatggcgtgtcctggcgggtgctgctggaa
gacctgcaggcgctgtaccgtggccagcctctgccggccaagacccacgccgtcggcgac
tgggctgcgcgcctggccagctacgccggcagcgattcgctgcgtgacgaactggcctgg
tggcaaggccagctgggcggtgtgcgtcgcgaattgccgtgcgaccatccgcagggcagc
aatttgcatcgccacgctcaaaccctggccatcggcctggacgtggagcaaacccggcag
ctgttgcaactggccccggcggcttaccacacccaggtcaacgacctgctgttgactgct
ctggcgcgggccttgtgccgctggagcggcgatgaagaagtgctggtgcagctcgaaggc
catggccgtgacgggctgttcgaagacatggacctgacccgcagcgtcggctggttcacc
aatgcctacccactgagcctgcgtccgctgccaggtgaagacgacgcggcgcgggccggt
tcgatcaagcgcatcaaggaacaactgcgccatgtaccgcacaagggcctgggctacggc
gtactgcgctacctggcggatgccgccgggcgcgagcagatggcggccttgccgcaggcg
cgcatcaccttcaactacctgggccagttcgaccagcagttcgacagtgcggccttgttc
cagcccctggaggcctcggccgggttggcgcatgacctcgatgcgccgttgcccaactgg
ttgagcgtcgatggccaggtgtatggcggtgctctgcaactgcgctggaccttcagcgcc
gagcgctacgaccagcagaccatcgcgcgtctggctgagggctatcgtcaggagctgctg
gcgctggtcgcgcattgcctggccgatggcaatggcagcttcaccccatcggacttcccg
ctggcgcacctgactcaggagcagatcgacgcattgccggtcccggccgcgcagatcgag
gacgtttacccgctgacgccgatgcaggaaggcatgctgctgcacaccctgctggagccg
ggcactggcctgtactacatgcaggaccgctaccgcatcaacagcgcgctcgaccccgag
cgtttcgcccaggcctggcaggccgtggtggcgcgccacgaagcgttgcgcgcctcgttc
agctggaacagcggcgaggcgatgctgcagatcatccacaagccgggcaacctggcggtg
gactaccaggactggcgcggcctggccgacgatgcccaggagcagcgcctgcaggccctg
cacaagcaggagcgcgaggccggctttgccttgctcagcgaggcaccgttccacctgcgc
ctggtgcgcgtggccgaggaacgctactggttcatgatgagcaaccaccacatccttatc
gatgcctggtgccgctcgctgttgatgaacgatttcttcgaggtctaccaggcccttggc
gaaggccgtcaggcccaactgccggtgccaccgcgttaccgcgattacatcggttggctg
caacgccagggcctggacgacgcacgtgcctggtggcaggccaacctggccggcttcgaa
cgtgccacagccatcccgagcgaccgcccgctgcgccatgaccacgccggtagcggcatg
gtcgtcggcgattgttatacccgccttgagatgaatgatggcgtgcgtctgcgcgaactg
gcccaggcccatcagctcaccgtcaacactttcgcccaggcggcctgggccctggtgctg
tcgcgctacagcggcgaccgcgacgtggcctttggcgtaaccgtggccgggcgcccggtg
agcatgccgcagatgcagcgcaccgtcggcctgttcatcaacagcgtggccctgcgtgtg
cagttgcctgcggcgagtgagcgctgcagtgtgcgccagtggctgcaaggcctgctgcaa
agcaacatggagctgcgcgagtacgaatacctgccgctggtggcgatccaggcgtgcagc
gagctgcccaagggccagccgctgttcgacagcctgttcgtgttcgagaatgcgccggtt
gaaaccgccgtgctcaatcacgcccagcacctgaacgccagctccgactcgggccgtacc
cacaccaacttcccgctgacggcggtgtgttacccgggtgatgacctgggcctgcacctg
tcgttcgaccagcgctacttcgactacccgaccgtcgagcgcctgctggccgaattcaag
cgcctgctgctggcgctggtacaaggttttgaaggggaggtgagcgagctaccgctgctg
agcgcccaggagcaaggcttcctgctggaggactgcaaccggaccgagcgggtttatccg
ctggagcagagctacatcgcgcagttcgaagcgcaggttgtggcgcatccacagcgtacc
gtggcccgctgcctggaggcatcctatgattacgccgggctgaacctggcggccaaccgc
ctgggccatgcgctggtggctgccggcgtctgcgtggaccagccagtggcactgcttgcc
gagcgtgggttgccgctgctgggcatgatcgtcggcagcttcaaggccggcgccggctac
ctgccgctggacccgggcctgccggcggcgcgcctgcaaagcatcatccagctcagccgc
acgccagtgctggtgtgcagcgcggcctgcgccgagcaggggcggcagttgctcggtgag
ctggaggcttcgctgcggccgcaactgctggtctgggaagacgtccaggccaacccgatc
gcaagccacaacccgggcatccacagtggcccggacaacctcgcctacgtgatctacacc
tcaggctcgaccggcctgccgaaaggggtgatggtcgagcagcgcggcatgctcaacaac
cagctgagcaaggtgccttacctggcgctcagcgagcaggacgtgattgcccagaccgcc
tcgcaaagcttcgacatctcggtctggcagttcctggctgcgccgctgttcggcgccaag
gtagagatcgtgcctaatgtcatcgcccatgacccgcagggcctgctggcgcacgtgcag
gccaccggcatcaccgtgctggagagcgtgccgtccctgatccagggcatgctggccagc
gaccaccaggccctcgacggcctgcgctggatgctgccgaccggcgaggtcatgccaccg
gagctggcggcgcagtggctgcagcgctacccgcagatcggcctggtcaatgcctatggc
ccggcggagtgctcggatgacgtggcgttcttccgcgtcgatgccgcctcgacccaaggc
agctacctgccaatcggcacgccaaccgataacaaccgcctgtacctgttcggcgaggac
caggcgctggtgccgctgggggcggtgggcgagttgtgcgtggcgggtgcgggtgtaggc
cgtggctacgtcggtgacccggtgcgcacggcactggcgttcattcctcacccttacggg
gcaccgggagagcgcctgtaccgtaccggtgacctcgcacggcagcgcctggacggtgtg
ctggagtacgtcgggcgcatcgaccatcaggtgaagattcgcggctatcgcatcgagctg
ggcgaaatcgaggcccggctgcatgagcaggcggaaattcgcgatgctgctgtggcggtg
caggagggagtgaacggcaagcatctggttggctacctggtggcgcaccagggcgtcagt
gccgatgccgcgttgctggagcaggtcaagcaacgactgcgtgccgagttgccggagtac
atggtgcccttgcactggggctggttcgacagcttgccgcacaacgccaacggcaagctc
gaccgcaaggccctgccagccatcgacatcggcggtcagtacagtcaggcctatctggcg
ccacgcaacgaattggaggacgtgttggcgggtatttgggccgatgtgctcaaagccgag
cgggtgggagtgcacgacaacttcttcgagctgggcgggcattcattgctggccacgcag
atcgcttcgcgggtgcagaagcagctacagctgaacgtgccgctgcgggcgatgttcgag
tgcagcacggtggaggcgttggccgagtatgtacaggggctgcagggcagtgcgctggat
gatgacaaggtcgaccggctcagtgacctgatggcggaactggaggggctgtga

DBGET integrated database retrieval system