KEGG   Pseudomonas putida HB3267: B479_18075Help
Entry
B479_18075        CDS       T02389                                 

Definition
(GenBank) peptide synthase
Organism
ppuh  Pseudomonas putida HB3267
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3979566..3992519)
Genome map
AA seq 4317 aa AA seqDB search
MTDAFELPLSLVQALAQRAAQTPDKVALRFLADAPGEQAVLSYRDLDQRARTIAAALQSR
AGFGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESARQHHQQRLLSIIDDAEPRLL
LTVAALRDSLQGLEALTAANAPELLAVDGLDPALAANWREPALKGDDIAFLQYTSGSTAL
PKGVQVSHGNLVANEQLIRQGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVL
MSPGYFLARPLRWLQAISEYGGTISGGPDFAYRLCSERVSEASLAGLDLSRWRVAYSGSE
PIRQDSLAAFADKFQACGFDPQSFFASYGLAEATLFVSGSRRGQGIAALELDAEAFAANR
AEPGKGSVLMSCGYPQPGHAVRIVEPQRLQVLDDNQVGEIWAAGPSIALGYWRNPEASAR
TFVDMDGQTWLRTGDLGFMREGEVFVTGRLKDMLIVRGQNLYPQDLEKTLEREVDVLRKG
RVAVFAVEQQGEEGIGVAVEISRNVQKAIKPQELIKTLRQVIADACRQAPAVVLLLNPGA
LPKTSSGKLQRSACRLRMDDGSLDCYARFPEVNEPVASVGAGDELQARIADVWRDILKVE
AVAADDHFLLLGGNSIAATHATARLADELGIELGLRTLFEAPILADYAKAVAAIISEGGG
RVGAIATLERTQALPQSLAQNRLWLLWQLDPQSAAYNIPAGLQLRGELDENALETAFQAL
VARHESLRTLFAEENGQALQRIQAQQPFDLRRLDLEGQAAEQVAAQRETEARQPFDLTRG
PLLRVTLARLDDEHHQLWVTLHHIVADGWSLNILLDEFAKLYAAHCQGLEANLAPLTLGY
ADYGTWQRQWLAAGEAERQLQYWQARLGDDLPVLDLCTDHPRTSQRGHRAARFNLKVPAR
LTEALKGLAREQQASLFMVLLAGWQALLHRYSGQADIRVGVPNANRPRLETQGMVGFFIN
TQVLRAQLDGRLPFDQLLAQVRQATLDAQANQDLPFEQLLEALPEAREQGLFQVMFNHQQ
RDLSALRRLPGLLAEELPWHSREAKFDLQLHSEEDHQGRLSLAFDYAAELFDASTVKRLA
QHLLALLEQVCAGPQRALGEVQLLDEPGRAQLLSWGEAPAAPPQRLLVEQLNEQARLTPQ
RTALVWDGGSLDYAELHQQANRLAHYLRDKGVGPDTCVAIAIERSPQLLVGLLAILKAGG
AYVPLDIDYPAERLAYMLADCNAGLLLSHSSLLGKLPQVDGVSAIALDQLHLDSWPSHAP
GLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQASYVLDDSDVLMQKAPISFD
VSVWECFWPLVTGCKLVLAGPGEHRDPQRIAALVQAHGVTTLHFVPPLLQVFVQEPQAGA
CGSLRRLFSGGEALSAALRDRVLQVLPQVQLHNRYGPTETAINVTHWHCQATDGERSPIG
RPLGNVLCRVLDDELELSAPGVPGELYLGGAGLARGYLGRPGLTAERFVPRADGNGERLY
RSGDRARWQVQTAALEYLGRLDQQVKVRGFRVEPEEVQACLLAQAGVEQALVLIHKDAVG
AQLVGYYSGSAQPDALLTVLAEQLPAYMVPAQLIPLAQMPLGPSGKVDRKALPAPVWQQR
QHVKPQTELQQQVAAIWREVLNLPRIGLQDDFFALGGHSLLATQIVSRTRQACDVELPLK
ALFDASELGAFCAEITRIRAAGERNLQGSIARVDRRQAVPLSYSQQRMWFLWQMEPGSPA
YNVGGMARLRGTLHVDAFERALQALVVRHETLRTTFPSIDGVPYQCVAEDSSLHLDWQDF
SALPADLRQQRLQQLADDQAHQPFDLERGPLLRACLVKAEEREHFFVLTLHHIVTEGWAM
DIFARELGELYEAFVDDRESPLAPLPVQYLDYSVWQRQWLESGEGARQLAYWQARLGDEH
PVLALPADRPRPAVQSHRGELYRFELDPALVSRVHAFNSQRGLTLFMTMTATLAALLHRY
SGQRDLRIGAPVANRIRPESEGLIGAFLNTQVLRCELDGQMSAAQLLEQVRQVAIEGQSH
QDLPFDQLVEALQPPRSSAYNPLFQVMCNVQRWAFQQSRQLAGMQVDYLVNDASATKFDL
YLEVTDLDGRLGCCLTYSRDLFDEPRIARMAEHWQQLLVGLLDNPQQRLCELPMLSSAEQ
QLLAGRLQGEQGLALDQTVHGLFAAQAARTPHAGALTFAGRHMTYAELDQQANRLARALR
ERGVGPQVRVGLALERSLEMVIGLLAILKAGGAYVPLDPEYPLDRLRYMIEDSRIGLLLS
QRALLQTLGQLPEGVAHWSLEDDSASLSAYSYAPLDNLNLPQHQAYLIYTSGSTGKPKGV
VVSHGEFAMHCQAVIDAFGMRGDDCELHFYSINFDAASERLWVPLLCGARVVLRAQGQWG
AEDICQLVREQQVSILGFTPSYGSQLAQYLAGQGEQLPVRLVITGGEALTGEHLQRIRQS
FAPQQFFNAYGPTETVVMPLACLAPQTLPAELGSVPIGRVIGSRTAYILDEDLALLPQGG
VGELYVGGAGLAQGYHDRPGLSAERFVADPFGSEGGRLYRTGDLVRLGSDGLVEYVGRAD
QQVKIRGFRIELGEIESRLQAHADVDEAVVLALDLPGGKQLVGYLVCRQAAADSEVQGML
RDAVKADARQHLPDYMVPAHLVLLDSLPLMGNGKLDRRALPLPDLEQARQQYQAPGNEVE
AQLAQIWRDVLNVARVGVQDNFFELGGDSILSIQVVSRARQAGLQFTPRDLFQHQTIQTL
AAIVQRSEAASSIEQGLRQGQAGLTPIQHWFFDSKVPQPQHWNQAVLLEARKPLDEGVLK
RALADLVQHHDSLRLRFSQAQGRWQAEYASLATGQLLWTATVADFADCQPLYTDLQRSLD
LEQGPLLRALLVNDGQGGQRLLLAIHHLVVDGVSWRVLLEDLQALYRGQPLPAKTHAMGD
WAARLAIYAGSDSLRDELGWWQGQLGGVRRELPCDHPQGGNLHCHARTLAIGLDVEQTRQ
LLQQAPAAYHTQVNDLLLTALARALCRWSGDEEVLVQLEGHGRDGLFEDMDLTRSVGWFT
NAYPLSLRPLPGEDDAARAGSIKRIKEQLRQVPHKGLGYGVLRYLADTAVREQMAALPQA
RITFNYLGQFDQQFDSTALFQPLDAAAGLAHDLDAPLPNWLSVDGQVYGGALQLRWTFSA
ERYDERTIACLAEAYRQELLALVEHCLADGNGSFTPSDFPLAHLTQAQIDALPVPAAQIE
DVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSALDPERFAQAWQAVVARHEALRASF
SWNTGEAMLQIIHKPGNMPVDYQDWRGLDDDAQEQRLQALHKQEREAGFALLSEAPFHLR
LVRVADERYWFMMSNHHILIDAWCRSLLMNDFFEIYQALGEGRQARLPVPPRYRDYIGWL
QRQGLDDARAWWQANLAGFERATTIPSDRPLRHDHAGSGMIVGDCYTRLAVSDGVRLREL
AQAHQLTVNTFAQAAWALVLARYSGDRDVAFGVTVAGRPVSMPQMQRTVGLFINSVALRV
QLPVAGERCSVRQWLQGLLEHNMELREHEYLPLVAIQECSELPKGQPLFDSLFVFENAPV
ETAVLDHAQHLNASSDSGRTHTNFPLTAVCYPGDDLGLHLSFDQRYFDYPTVERLLAEFK
RLLLALVQGFEGEMSALPLLGAEEQRFLLEDCNRTARAYPLEQSYIAQFEAQVAAHPQRT
VARCLDASYDYAGLNLAANRLGHALIAAGVNVDQPVALLAERGLPLLGMIVGSFKAGAGY
LPLDPGLPAARLQSIIQLSRTPVLVCSAACAGQGRQLLDQLALAARPQLLVWEDIQASPV
ASHNPGIHSGPDNLAYVIYTSGSTGLPKGVMVEQRGMLNNQLSKVPYLALGEQDVIAQTA
SQSFDISVWQFLAAPLFGARVEIVPNAIAHDPQGLLAHVQATGISVLESVPSLIQGMLAN
DHQALDGLRWMLPTGEAMPPELAAQWLQRYPQIGLVNAYGPAECSDDVAFFRVDAASTRG
SYLPIGTPTDNNRLYLYGEDQALVPLGATGELCVAGTGVGRGYVGDPVRTALAFIPHPHG
APGERLYRTGDLARQRLDGVLEYVGRIDHQVKIRGYRIELGEIEARLHEQPEIRDAAVGV
QEGVNGKHLVGYLVAHQGVAADAALLEQLKQRLRAELPEYMVPLHWGWFDSLPHNANGKL
DRKALPAIDVGGQHSQAYQAPRNELEEVLAGIWTDVLKAERVGVHDNFFELGGHSLLATQ
IASRVQKQLQLNVPLRAMFECSTVEELAVYVRGLQGSVLDDDKVDRLSDLMAELEGL
NT seq 12954 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgccttcgaactcccgctctcgctggtccaggccctggcgcaacgcgccgcg
cagaccccggacaaagtcgccttgcgctttctggccgacgctcccggcgagcaggccgtg
ctcagctaccgggacctcgaccagcgcgcacgcaccatcgctgctgccttgcaaagccgg
gccggtttcggcgaccgcgcagtgctgttgttccccagcgggccagactatgtggcggcg
ttcttcggctgcttgtatgccggcgtgattgcggtgccggcctacccgccggagtccgcg
cgccagcaccaccagcagcgcttgctgtcgatcatcgacgacgcagagccgcgcctgctg
ctgaccgtcgcggccctgcgcgacagcctgcagggcctggaggccctgacagcggccaac
gcccccgagctgctggcggtggatggcctggacccggcactggctgcaaactggcgcgaa
cccgcgctcaagggtgatgacatcgccttcctgcaatacacctccggctccacagcactg
cccaagggcgtgcaggtcagccatggcaacctggtggccaacgaacaactgatccgccaa
ggctttggcatcgacctcaacccagacgatgtgatcgtcagctggctgccgctgtaccac
gacatgggcctgatcggcggcctgctgcagccgatcttcagcggcgtgccctgtgtgctg
atgtcgccgggctacttcctggcccggccgctgcgctggttgcaggccatcagcgaatac
ggcggcaccatcagcggcggccccgactttgcctaccggttgtgcagcgagcgggtcagc
gaggcctccctggccgggctcgacctaagccgctggcgggtggcctattctggctccgag
ccgatccgccaggacagcctggcggcctttgccgacaagttccaggcctgcggcttcgac
ccgcagagcttcttcgccagctacggcctggccgaggcgaccctgttcgtcagcggtagt
cgccgtggccagggcatcgccgcgctggagctggacgccgaagccttcgccgccaaccgt
gcggagcctggcaagggcagtgtgctgatgagctgtggctacccgcagcccgggcatgcc
gtgcgcattgtcgaaccacaacgcctgcaggtgctggacgacaaccaggtgggcgagatc
tgggccgccggcccgagcatcgccctgggctactggcgcaaccccgaggccagcgcccgc
accttcgtcgacatggacggccagacctggctgcgtaccggtgacctgggcttcatgcgc
gaaggcgaagtgttcgtcaccggccgcctgaaggacatgctcatcgtgcgcgggcagaac
ctgtacccgcaggacctggaaaaaaccctcgagcgcgaagtggatgtgctgcgaaaaggc
cgggtggcagtgttcgccgtcgagcagcaaggcgaggagggcattggcgtggcggtggaa
atcagccgcaacgtgcagaaggcgatcaagccccaggagctgatcaagaccctgcgccag
gtgatcgccgacgcctgccgccaggcaccggccgtggtcctgctgctgaacccgggtgcg
ctgcccaagacctccagcggcaagctgcagcgttcggcctgccgcctgcgcatggacgat
ggcagcctggactgctacgcccgcttccctgaggtgaacgagcccgttgcttcagtgggc
gcaggcgatgaactgcaggcgcgcatcgccgatgtgtggcgcgacattctcaaggtcgag
gcggtggcggcagacgaccacttcctgctgctgggcggcaactcgatcgccgccacccac
gccaccgcacgcctggccgatgaactgggcatcgagctgggcctgcgcaccctgttcgaa
gcgccgatactggctgactacgccaaggccgtggccgcgatcatctccgaaggcggtggc
cgggtcggtgccatcgctacactggaacgcacccaggcgctgccccagtcgctggcgcaa
aaccgcctgtggttgctgtggcagttggacccgcagtcggcggcctacaacattccggcc
ggcctgcagttgcgcggtgagctggacgaaaacgccctggaaacagccttccaggcgctg
gttgcgcgccatgaatcgctgcgcaccctatttgccgaagagaacggccaggccctgcag
cgcatccaggcgcagcagccgttcgaccttcgccgcctggacctcgaaggccaggccgcc
gaacaggtcgccgcccaacgtgaaaccgaagctcgccagccgttcgatctgacccggggg
ccgttgctgcgggtgaccctggcgcgcctggacgatgaacaccatcaactatgggtgacc
ctgcaccatatcgtcgccgacggctggtcgctgaacatcctgctcgacgaattcgccaaa
ctgtacgccgcccactgccagggccttgaggccaacctggcaccgctgaccctgggttat
gccgactacggcacctggcagcgacagtggctggccgcaggcgaagccgagcgtcagctg
cagtactggcaggcgcgtctgggggatgatctgccggtgctcgacctgtgcaccgaccac
ccgcgcaccagccagcgcggccaccgcgccgcccgcttcaacctcaaggtaccggccagg
ctcaccgaagcgctcaagggcctggcccgcgaacagcaggccagcctgttcatggtactg
ctggccggctggcaggcgctgttgcaccgctacagtggccaggccgatatccgtgtcggc
gtgcccaacgccaaccgcccgcgcctggaaacccaaggcatggtcggcttcttcatcaac
acccaggtgctgcgtgcgcagctcgacggccgcctgccgttcgaccagttgctggcccag
gtgcgccaggccaccctggatgcccaggccaaccaggacctgccgttcgagcaactgctc
gaagccctgcccgaggctcgcgagcaaggcctgttccaggtcatgttcaaccaccagcaa
cgtgacctgtctgcgctgcgccgcctgccgggcctgctggccgaagagctgccgtggcac
agtcgcgaagccaagttcgacttgcagctgcacagtgaagaagaccaccagggccgcctg
agcctggccttcgactatgccgccgaattgttcgatgccagtaccgtcaagcgcctggcc
cagcacctgttggccctgctcgagcaggtgtgtgccgggccgcagcgggcgctgggcgag
gtgcaactgctcgacgagcctggccgcgcgcaactgctgagctggggcgaggcacccgct
gcgccgccgcagcgcctgctggtcgagcagctcaatgaacaggcacgcctgaccccgcag
cgcaccgccctggtgtgggacggtggcagcctggattacgcagagttgcaccagcaagcc
aaccgtctggcccactacctgcgtgacaaaggcgtgggcccagacacttgcgtggccatc
gccatcgagcgttcgccgcagctgctggtgggcctgctggccattctcaaggccggtggt
gcctatgtgccgctggacatcgattacccggccgagcgcctggcctacatgctcgccgac
tgcaacgctggcctgttgctgagccacagcagcctgctgggcaagctgccacaggttgat
ggcgtcagcgccatcgccctcgaccagctgcacctggacagctggccaagccatgccccc
gggttgcatctgcatggcgacaacctggcctatgtgatctacacctccggctccaccggc
cagcccaagggcgtgggcaatacccacgcggcactggccgagcgcctgcaatggatgcag
gccagttatgtgctggacgacagcgacgtgctgatgcagaaggcgccgatcagcttcgac
gtttcggtgtgggaatgcttctggccactggtgaccggttgcaagctggtgctcgccggc
cctggcgagcaccgcgacccgcagcgcatcgccgcgttggtgcaggcccatggcgtgacc
acgctgcacttcgtgccgccgctgttgcaggtgttcgtccaggagccgcaggcgggtgcc
tgcggcagcctgcgccggctgttctccggtggcgaagcgctgtccgcggcactgcgtgac
cgcgtgctgcaggtgctgccacaggtgcagttgcacaaccgctatggcccgaccgaaacc
gccatcaacgtcacccactggcactgccaggccaccgatggcgaacgctcgccgatcggc
cgcccgctgggcaatgtgctgtgccgtgtgctggacgacgagctggaactgtccgccccc
ggtgtgccgggcgagctgtacctcggcggtgcaggcctggcccgtggctacctgggccgc
ccgggcctcaccgccgagcgcttcgtgccccgggccgacggcaatggcgagcgcctgtac
cgcagtggcgaccgcgcccgctggcaggtgcagaccgcggcgctggaataccttggccgc
ctcgaccagcaggtcaaggtgcgtggcttccgtgtcgaacccgaggaagtccaggcctgc
ctgctggcgcaagcgggggtcgaacaggcgctggtgctgattcacaaggatgccgtaggt
gcgcaactggtcggctactacagtggcagcgcccagcctgatgcattgctgacggtgctg
gctgaacaactaccggcctacatggtgccggcacaactcatcccgctggcgcagatgcca
ctgggccccagcggcaaggtcgaccgcaaggcattgccggccccggtgtggcagcagcgg
cagcacgtcaagccgcaaaccgagttgcagcagcaggtcgccgctatctggcgcgaggtg
ctgaacttgccgcgcatcggcctgcaggacgacttcttcgccctcggcggccattcgctg
ctggccactcaaattgtctcgcgcacgcgccaggcctgcgatgtcgagctgccgctcaag
gccctgttcgacgccagcgagctgggcgccttctgtgccgagatcacgcgtattcgtgct
gccggtgagcgcaacctgcaaggttcaatcgcccgcgtcgaccgccgccaggcggtgccg
ctgtcgtactcgcagcagcgcatgtggttcctctggcaaatggagccgggcagcccggcg
tacaacgtcggcggcatggcgcgcttgcgcggcaccctgcatgtggatgccttcgagcga
gcgctgcaggcgctggtggtgcgccacgaaaccctgcgcaccaccttccccagcatcgat
ggcgtgccgtatcagtgcgtggccgaagacagcagcctgcacctcgactggcaagacttc
agcgccttgcccgccgatctccgccaacaacgcctgcagcaactggccgacgaccaggcg
caccagccgttcgacctggagcgcggcccgctgctgcgtgcctgcctggtcaaagccgaa
gagcgcgagcatttcttcgtgctgaccctgcaccatatcgtcaccgagggctgggccatg
gacatcttcgcccgcgaactgggcgagctgtacgaggccttcgtcgatgaccgcgaatcg
ccgctggcgccgctgccggtgcagtacctggactacagcgtgtggcaacggcaatggctg
gaaagcggcgagggcgcccgccagctggcctactggcaggcccgcctgggcgatgaacac
ccggtactggcgctgcctgccgaccgcccgcgcccggcagtgcagagccaccgtggcgag
ctgtaccgcttcgagctcgacccggcgctggtctcccgcgtgcatgccttcaacagccag
cgcggcctgaccctgttcatgaccatgactgccaccctggccgccttgctgcaccgctac
agcggccagcgtgacttgcgcattggcgcgccggtggccaaccgcatccgcccggaaagc
gaagggctgattggcgcgttcctcaacacccaggtgctgcgttgcgagctggacggccag
atgagcgccgcacagttgctggagcaggtacgccaggttgccatcgaaggccagtcgcac
caggacctgccgttcgatcagctggtggaagccctgcagccaccgcgcagcagcgcctac
aacccgctgttccaggtgatgtgcaacgttcagcgctgggccttccagcaaagccgtcag
cttgccggcatgcaggtggattacctggtcaacgacgccagcgccaccaagttcgacctg
tacttggaggtgaccgacctcgacggccgcctgggttgctgcctgacctacagccgtgac
ctgttcgacgaaccacgcatcgcgcgcatggccgagcattggcagcaattgctggtgggc
ctgctcgacaacccgcaacagcgcctgtgcgagctgccgatgctgagcagcgccgagcag
cagttgctggctggccggttgcagggcgagcagggtctcgctctcgaccagaccgtgcac
ggcctgttcgccgcccaggctgcgcgtacgccacacgctggcgcgttgacgtttgccggc
cggcacatgacctatgccgaactcgaccagcaggccaaccgcctggcccgcgccctgcgc
gagcgtggcgtcggcccgcaggtgcgcgtgggcctggcactggagcgttcgttggaaatg
gtcatcggcttgctggccatcctcaaggccggtggcgcctacgtgccgctcgaccccgaa
tacccgctcgaccgcctgcgctacatgatcgaagacagccgcatcggcctgctgctaagc
cagcgcgcgctgctgcaaaccctggggcagctgcccgaaggcgtggcgcactggagcctg
gaggacgacagcgccagcctgtcagcctacagctatgcgccgctggacaacctcaacctg
ccgcagcaccaggcctacctgatctacacctccggttccaccggcaagcccaagggcgtg
gtagtcagccacggcgagttcgccatgcattgccaggcggtgatcgacgcgttcggtatg
cgcggcgatgactgcgagctgcacttctattcgatcaatttcgacgccgccagcgaacgc
ctgtgggtgccgctgctgtgtggcgcccgcgtggtactgcgtgcccaggggcagtggggc
gccgaagacatctgccagctggtgcgtgagcagcaggtgagcattcttggcttcacgcca
agctacggcagccagttggcgcagtacctggccgggcagggcgagcagttgccagtgcgc
ctggtcattaccggtggtgaagcgctgaccggcgaacacctgcagcgcatccgccagtcc
ttcgcgccgcagcagttcttcaacgcctacgggccgaccgaaaccgtggtcatgccgctg
gcctgcctggcaccacagacgctgccggcggagctgggcagcgtaccgatcggtcgcgtc
atcggtagccgcacggcctacatcctcgatgaagaccttgccctgttgccgcaaggcggt
gttggcgagctgtatgtcggcggtgccggcctggcccagggttaccacgaccgcccgggc
ctaagcgccgagcgcttcgtcgccgacccgttcggcagcgaaggcgggcgcctgtatcgc
accggtgacctggtgcgcctgggcagcgatggccttgtcgagtacgtcggtcgcgccgac
cagcaggtgaagattcgcggtttccgtatcgagctgggcgaaatcgaaagccgcctgcag
gcgcatgccgatgtcgacgaagctgtggtgctggccctcgacctgccgggcggcaagcaa
ctggtgggttacctggtgtgcaggcaggccgctgccgacagcgaggtccagggcatgctg
cgcgacgcggtgaaagccgatgcccgccagcacctgccggattacatggtgccggcgcac
ctggtgctgctcgacagcctgccgctgatgggcaacggcaagctcgaccgccgtgcgctg
ccgctgccggacctggaacaggcacgccagcagtaccaggcgcctggcaacgaggtggaa
gcgcaactggcgcagatctggcgcgacgtgctcaacgttgcccgggtcggcgtgcaggac
aacttcttcgagctgggcggcgactcgatcctgtcgatccaggtagtcagccgggcccgc
caggccggcttgcagttcactccgcgcgacctgttccagcatcagaccatccagaccctg
gccgccatcgttcagcgcagcgaagccgccagcagcatcgaacagggcctgcgccagggc
caggccggcctcacgccgatccagcactggttcttcgacagtaaagtgccacagccgcag
cactggaaccaggctgttctgctggaggcacgcaagccgctggatgagggggtactgaag
cgagccttggccgacctggtgcagcaccacgacagcctgcgcctgcgcttcagtcaggcc
cagggccgctggcaggccgaatatgcttcgcttgccaccgggcaattgctgtggacagcc
acggtcgccgacttcgccgattgccaaccgctgtacaccgatttgcaacgcagcctcgac
ctggaacagggcccactgttgcgcgccttgctggttaatgacgggcagggcggccagcgc
ctgttgctggctatccatcacctggtggtcgatggcgtgtcgtggcgcgtgctgctggaa
gaccttcaggcgctgtaccgaggccagccgctgccggccaagacccacgccatgggcgac
tgggccgcacgcctggccatctatgccggcagtgattcgctgcgcgacgagctgggctgg
tggcaaggccagttgggcggcgtgcgccgcgaactgccatgcgatcacccgcagggcggc
aacctgcactgccatgcccgtaccctggccatcggcctggatgtggagcagacccggcag
ttgctgcagcaggccccggcggcctatcacacccaggtcaacgacctgctgctgaccgcg
ctggcgcgtgccctgtgccgctggagcggcgacgaagaagtgctggtacagcttgaaggc
catggccgtgacgggctgttcgaagatatggacctgacccgcagcgtcggctggttcacc
aacgcctacccgctgagcctgcgcccgctgccaggcgaggacgatgcagcgcgggcaggc
tcgatcaagcgcatcaaggagcaactgcgccaggtgccgcataaagggctgggttatggc
gtgctgcgctacctggccgatacggcagtgcgtgagcagatggcggccctgccgcaggca
cgcatcaccttcaactacctgggccagttcgaccagcagttcgacagcacagccctgttc
cagccgctggacgccgcggccggcctggcccacgacctcgatgcaccgctgcccaactgg
ctgagtgtcgatggccaggtgtatggcggtgccctgcaactgcgctggaccttcagtgcc
gaacgctacgacgagcggaccatcgcctgcctggccgaggcctatcgtcaggagctgctg
gcgctggtcgagcattgcctggctgatggcaacggcagtttcacgccatcggacttcccg
ctggcgcacctgacccaggcgcagatcgacgcgctgccggtaccggcagcgcagatcgag
gatgtctatcccctgacgccgatgcaggagggcatgctgttgcacaccctgctggagccg
ggcaccggcctttactacatgcaggaccgctaccgcatcaacagcgcgctcgaccccgaa
cgcttcgcccaggcgtggcaggcggtggtggcacgccacgaggcgctacgcgcatcgttc
agctggaacaccggcgaggcgatgctgcagatcatccacaaaccgggcaacatgccggtg
gactatcaggactggcgtggcctcgacgacgacgcccaggagcagcgcctgcaggccctg
cacaagcaggaacgcgaggctggtttcgcgctgctcagcgaggcgccgttccacctgcgc
ctggtgcgtgtggccgacgagcgctactggttcatgatgagcaaccaccacatcctcatc
gatgcctggtgccgttcgctgctgatgaacgatttcttcgagatctaccaggccctcggc
gaggggcgccaggcccgcttgccggtgccaccgcgctaccgcgactacatcggctggctg
caacgccagggcctggacgacgcgcgagcctggtggcaggccaacctggccggcttcgaa
cgcgctaccaccatccccagcgaccgcccgctgcgccacgaccatgccggtagcggcatg
atcgtcggcgactgttacacccgcctggcggtgagcgacggtgtgcgcctgcgcgaactg
gcccaggcccaccagctcaccgtcaacaccttcgcccaggcggcctgggcactggtgctg
gcgcgctacagtggcgaccgcgacgtggcctttggcgtgaccgtggccgggcgcccggtg
agcatgccgcagatgcagcgtaccgtcggcctgttcatcaacagcgtcgccctgcgcgtg
caattgccggtggcgggtgagcgctgcagcgtgcggcagtggctgcaaggcctgctggag
cacaacatggagctgcgcgagcatgagtacctgccgctggtggccatccaggaatgcagc
gaactgcccaagggccagccgctgttcgacagcctgttcgtgttcgagaacgcgccggtg
gaaaccgccgtgctcgaccacgcccagcacctgaatgccagttccgactcgggtcgtacc
cacaccaacttcccgctgaccgcagtgtgctacccgggcgatgaccttggcctgcacctg
tcgttcgaccagcgctatttcgactacccgaccgtcgagcgcctgctggccgagttcaag
cgcctgctgctggcgctggtgcaaggctttgaaggggagatgagcgcactgccgttgctg
ggtgcggaagagcagcgcttcctgctggaagactgcaaccgcaccgcgcgcgcctatccg
ttggaacagagttacatcgcgcagttcgaggcgcaggtggccgcgcatccgcaacgtacc
gtggcccgctgcctggacgcatcctacgactacgccggcttgaacctggcggccaaccgt
ctgggccatgccttgatcgcggcgggtgtgaacgtggaccagccggtggcactgctggcc
gagcgtgggctaccgctgctgggcatgatcgtcggcagcttcaaggccggcgccggctac
ctgccactggacccgggcctgccggcggcgcgtctgcaaagcatcatccagctcagccgt
acacccgtgctggtgtgcagcgcggcctgtgccgggcaagggcggcagttgctggaccag
cttgcgttggcggcacggccgcagctgctggtctgggaagacatccaggccagcccggtg
gccagccacaaccccggcattcacagcgggccggataacctcgcctatgtgatctacacc
tcaggctccaccggcctgccgaagggggtgatggtcgagcagcgcggcatgctcaacaac
cagttgagcaaggtgccgtacctggcgctcggcgagcaggacgtgatcgcccagacggcc
tcgcagagcttcgacatttcggtgtggcagttccttgccgcgccgctgttcggcgccagg
gtggagatcgtgccgaatgccatcgcccatgacccgcagggcctgctggcgcatgtgcag
gccaccggcatcagcgtgctggagagcgtgccgtcgctgatccagggtatgttggccaac
gaccaccaggccctcgatggcctgcgctggatgctgccgaccggcgaggccatgcctccg
gagctggcggcgcagtggttgcagcgctacccgcagatcggcctggtcaacgcctacggc
ccggcggagtgctccgatgacgtggcgttcttccgcgtcgatgccgcctcgacccgtggc
agttacttgccgatcggcacgccgaccgacaacaaccgcctgtacctgtacggcgaggac
caggcactggtgccactgggtgcgacaggtgagttgtgcgtggccggcaccggcgtgggc
cgtggctatgtcggcgacccggtgcgcacagcgctggcgttcattccccatcctcatggt
gcaccgggcgaacgcctgtatcgcactggcgacctggcgcggcagcgcctggacggggtg
ctggagtatgtcgggcgcatcgaccatcaggtgaagattcgcggctaccgcatcgaactg
ggcgaaatcgaagcccgcctgcacgaacagccggaaatccgcgacgctgccgttggcgtg
caggagggcgtcaatggcaagcacctggtgggttacctggtggcgcatcagggcgttgca
gccgacgctgcgttgctggaacagctcaagcagcgcctgcgtgccgagttgccggagtac
atggtgccactgcactggggctggttcgacagcctgccgcacaacgccaacggcaagctc
gaccgcaaggccctgccagccatcgacgtcggtggccagcacagccaggcctaccaggcg
ccgcgcaatgagctggaagaggtactggccggtatctggacggatgtgctcaaggccgag
cgggtcggggtgcacgacaacttcttcgagctgggcgggcattcgctgctggccacgcaa
atcgcctcgcgggtgcagaagcagctgcaactgaacgtgccgctgcgggcgatgttcgag
tgcagcacggtggaggaactggcggtgtatgtgcgggggctgcagggcagtgtgctggat
gacgataaagtcgaccggctcagtgaccttatggctgagctggaggggttgtga

DBGET integrated database retrieval system