KEGG   Pandoraea pulmonicola: RO07_23115Help
Entry
RO07_23115        CDS       T03553                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ppul  Pandoraea pulmonicola
Pathway
ppul00020  Citrate cycle (TCA cycle)
ppul00310  Lysine degradation
ppul00380  Tryptophan metabolism
ppul01100  Metabolic pathways
ppul01110  Biosynthesis of secondary metabolites
ppul01120  Microbial metabolism in diverse environments
ppul01130  Biosynthesis of antibiotics
ppul01200  Carbon metabolism
Module
ppul_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppul_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppul00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RO07_23115
  Amino acid metabolism
   00310 Lysine degradation
    RO07_23115
   00380 Tryptophan metabolism
    RO07_23115
Enzymes [BR:ppul01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     RO07_23115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N PFOR_II OPT
Motif
Other DBs
NCBI-ProteinID: AJC23586
UniProt: A0A0A8C7W2
LinkDB All DBs
Position
complement(3455580..3458435)
Genome map
AA seq 951 aa AA seqDB search
MMEQFQANSYLFGGNAPYVEELYESYLDNPASVPDNWRQYFDALQNVPAVDGSNANDVAH
APIVESFAQRAKANAFVPRAGASDLAMARKQVHVQSLVAAYRFLGARWANLDPLKRQERP
AIPELEPAFYDLTEADMDGVYSAENTYFGFEQASLRDLLKSLRDTYCGSIGAEYMYISDP
VQKRWWQERLEKVRATPNFSAEKKKHILERLTAAEGLERYLHTKFVGQKRFSLEGGESFI
VAMDELVHHAGAKGVQEIVIGMAHRGRLNVLVNTLGKMPSDLFAEFEGKHVDDLPAGDVK
YHKGFSSDVSTSGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGEADAASVLPVQVHG
DAAFAGQGVVMETLNLAQTRGYGTHGTVHIVINNQIGFTTSDPRDARSTTYCSDVVKMIE
APVLHVNGDDPEAVVLAMQLALDFRQEFKKDAVVDIVCYRKLGHNEQDTPAVTQPLMYKK
IAQHPGTRALYVEKLVTQGVITAEEGDGFVKAYRQAMDEGHHTIDPVLSNYKSKYAVDWV
PFLNRKWTDAADTAVPLNELKRLAERITTIPANFKVHPLVEKVINDRRKMGLGEQPLDWG
MGEHLAFASLVSSGFAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQHVADGQE
SFTVIDSVLSEEAVLGFEYGYSTAEPNTMVLWEGQFGDFANGAQVVIDQFISSGEVKWGR
VSGLTMLLPHGYEGQGPEHSSARIERYLQLCADTNMQVVQPTTPAQIFHLLRRQMIRQLR
KPLIVFTPKSLLRHKEAVSDLSELAEGGFQTVIGETDKTINAEKVKRVIACSGRLYYDLI
ARRREEKRDDVAIIRVEQLYPFPHKAFESELKKYKNLTDVVWAQDEPQNQGPWFYIEHHL
IESMSAGQKLAYAGRAASASPAVGYYAKHYEQLKQLLDTAFGRLKGATVAQ
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
ttgatggaacaattccaagcgaactcgtacctcttcggcggcaatgccccctacgtcgaa
gaactgtacgaatcgtatcttgataatccggcgtccgtgccggacaactggcgtcagtat
ttcgacgcactgcaaaacgtccccgctgttgatggttccaacgccaacgacgtggctcac
gccccgatcgtggagtcgttcgcccagcgcgccaaggccaatgccttcgtgccgcgcgcc
ggcgcctctgacctggccatggcccgcaagcaggtgcacgtgcagtcgctcgtcgccgct
taccgcttcctcggcgcccgctgggccaatctggacccgctcaagcgtcaggaacgcccg
gcgattcccgaactggagcccgccttctacgacctgaccgaagccgacatggacggcgtg
tattcggcagagaacacgtatttcggttttgaacaggccagcctgcgcgatctgctcaag
tcgctgcgcgacacgtactgcggctcgatcggcgccgagtacatgtacatcagcgatccg
gtgcaaaagcgctggtggcaggagcgtctggagaaggtgcgtgccacgcccaacttcagc
gcagagaagaagaaacacatcctcgaacgcctgacggccgcggaaggcctcgagcgttat
ctgcacaccaagttcgtcggccagaagcgcttctcgctcgaaggcggcgaatcgttcatc
gtggcgatggacgagctcgtccaccacgccggtgcgaagggcgtgcaggaaatcgtgatc
ggcatggcccaccgcggtcgcctgaacgtgctggtcaacaccctcggcaagatgccgtcg
gacctgtttgccgaattcgaaggcaagcacgtggacgatctgccggccggtgacgtgaag
taccacaagggcttctcgagcgacgtctcgacgagcggtggcccggtccacctgtcgctg
gcgttcaacccgtcgcacctcgaaatcgtgaacccggtggtcgaaggctcggccaaggcc
cgtatggaccgccgcggcgaagctgatgcggccagcgtgctgccggtgcaagttcacggc
gacgccgccttcgcgggccagggcgtcgtgatggaaacgctgaacctcgcgcaaacgcgt
ggttacggcacgcacggcacggtgcacatcgtcatcaacaaccagatcggcttcaccacg
tcggatccgcgtgacgcccgttcgacgacgtactgctcggacgtggtcaagatgatcgaa
gcgccggtgctgcacgtgaacggcgacgatcccgaagcggtcgtgctggccatgcaactg
gccctggatttccgtcaggaattcaagaaggacgccgtcgtggacatcgtttgctatcgc
aagctgggccacaacgagcaggatacgccggcggtcacgcagccgttgatgtacaagaag
atcgcccagcatccgggcacgcgcgcgttgtacgtcgagaagctggtcacgcaaggcgtg
atcacggcggaagagggcgacggtttcgtcaaggcctatcgccaggccatggacgaaggc
catcacaccatcgatcccgtgctctcgaactacaagagcaagtacgcggtcgactgggtg
ccgttcctgaacaggaagtggaccgacgccgccgatacggccgtgccgctgaacgaactc
aagcgtctggccgagcgcatcaccacgatcccggcgaacttcaaggtccacccgctcgtc
gagaaggtcatcaacgaccgtcgcaagatgggcctgggcgagcagccgctcgactggggc
atgggcgagcacctggcttttgcctcgctggtttcgtcgggcttcgctgtgcgtctgacc
ggccaggattcgggccgcggtacgttcacgcaccgccacgccgtgctgcacgaccagaac
cgtgagcgttggaacgacggcacgtacgtgccgctgcaacacgtggccgatggccaggaa
agcttcacggtgatcgactcggtgctgtcggaagaagccgtgctgggcttcgagtacggt
tactcgaccgccgagccgaacacgatggtgctgtgggaaggccagttcggtgacttcgcc
aacggtgcacaggtcgtgatcgaccagttcatctcgagcggcgaagtgaagtggggccgc
gtctcgggcctgacgatgttgctgccgcatggctacgaaggccagggtccggaacactcg
tcggcacgtatcgagcgctacctgcaactgtgcgccgacaccaacatgcaagtggtccag
ccgaccacgccggcccagatcttccacctgctgcgtcgtcagatgatccgccagctgcgc
aagccgctgatcgtgttcacgccgaagtcgctgctgcgccacaaggaagccgtgagcgac
ctgtcggaactcgcagagggcggcttccagacggtcatcggtgaaaccgacaagacgatc
aacgctgagaaggtcaagcgcgtgatcgcctgctcgggccgcctctactatgacctgatc
gcccgccgtcgcgaagagaagcgggacgacgtcgcgatcattcgtgtggaacagctctac
ccgttcccgcacaaggcgttcgagagcgagctgaagaagtacaaaaacctcaccgacgtg
gtgtgggcccaggacgagccgcaaaaccagggtccgtggttctacatcgaacaccacctg
atcgagagcatgagcgccggtcagaagctggcttacgcggggcgcgcggcttcggcctcg
cctgccgtgggctactacgccaagcactacgaacaactcaagcagttgctcgatacggct
ttcggtcgcctcaagggcgcgaccgtggcgcagtaa

DBGET integrated database retrieval system