KEGG   Pandoraea pulmonicola: RO07_24080Help
Entry
RO07_24080        CDS       T03553                                 

Definition
(GenBank) hypothetical protein
Organism
ppul  Pandoraea pulmonicola
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3692528..3705790)
Genome map
AA seq 4420 aa AA seqDB search
MNDAFRLPVPFGPSSAASSDAPIETIVDLLRARARLEPEREALRAVASDEGDGQALSCAG
LDARARAVAATLQRLADGRAHGERGLLLMPTGLDYVTGFFGCLYAGVIAVPAFPPESARP
QHLARVRSILSDARARFVLTDQRHRDAMLAFGDAVPELRGVEIVVIDEIEESQADAWQPT
AIAPADLAFLQYTSGSTATPKGVMVSHANLMANEAAIVAGLGMTCDDTMVSWLPLYHDMG
LIGGLLSPIYRGARLVLMSPQFFLERPVRWLRAIDRFGGTVSGGPDFAYRLCAQRIDAAT
IAGLKLDGWRLAFSGSEPVRHDTLTDFCTAFAPAGFSPAAVYPCYGLAEATLFVTGGRRG
DGMTATAFDRGALGQQRARAGGDDVAMLVGCGVAPADHEVRLMTWSDAPDAVPGPVDAGG
TGEIWVSGSSVAQGYWHNETASARTFVQADGKRWLRTGDLGFMHDGQLYITGRCKDVIIV
RGHNLYPQDLEKAVETDVELVRKGRVTAFAVDIDGEPGIGIAAEVGRSVQKMVLPRTLAE
AVAVAVADACQQAPSVVVLLNPGALPKTSSGKLQRSACAQGWRDGALDAWSTWQNGVVLG
DLGNGMAKAQANTSAAMENGTAAAEADPRYEAVAAIWREVLGRATVKPDDHFFLCGGSSL
LAMQVLARVHERLGVRATPASLYEHARLGDWVRALAELSPESSDHADVSALRIPVATPLS
QTPHERVYRQSFAQARLWFQHRLDPANSAAFHVGGQLRVEGPFEVATFAQALGAVVARHD
ALRTTFGERDGVAVQIANTRVDLPLVQHDVAGEAEPAAVAGRLTEAALTEPFAPETSPPW
RVLALRIAPNEHRLVFVLHHLLTDAWSMTLLVDELAQAYGAIAAGTAPAFGASVLQPGDH
AHWQRARLDEATLGRQLDWWQARLPEPSPVLALPVDRARGATRGSAGATHALDFPAGLTR
NLREYAAQRKVTPFVVLAASFQWLLHRYAGESDVRVGVPVAHRDVAGLERMLGCLVNTQV
WRAQIDPAGDFDALVAQVRDGALDAQAHRDAPFERVVERIAPQRSLGHSPLFQVMLNHHT
ANAAARREIAGWPAGLAVSAQPLTGGAQYDLALDIDEWHDAAATDPLDGVTLRARLTFPT
DLFDVATIERMGRDWLTGLAALLALPTRALASLDVAFAPAENDTHRAVRLPAGVAFRSVP
ARIDAQAQRQPAAIALRDEAGTLTYAGLVAASNRIAHWLQAQGVAPEARIGLAMTRQTGM
IAGLLGIMKAGCAFVPLDPAYPAERLAQIIDDAGIALVLTETSLSQAFWQPARRGIVADI
VADTSLPGQATTTALRADQLAYLIYTSGSTGVPKGVAVEHGPLAMHCAATGEQYRLSPEV
CELHVLSINFDGAHERWMAPLAFGASLFIADERHWTPQTMVDAMRRHGVTNAGFPTAYLC
RLATSGATGAPALRLLSFGGEAMPLPALRAAQAMFRPAQTINGYGPTETVMTPVAWSIDG
DLDAQPAAGVAGQAYAPIGEPVGNRRAWVLDPWLGEVPLGAVGELYLGGEGVARGYFDRP
GLTAERFVPDPRGEPGARMYRTGDRVRRLANGALVYLGRFDQQIKVRGFRIEPGEVETQL
LREAGVDDALAVVAAGPAGDQLVAYVAGRGLDGEALRDALANRLPDYLVPALVMVLDTLP
KLPNGKRDRAALPAPVWGSTGGQAPESAAERALAAIWQTLLRQPAVSRDDNFFALGGDSI
VALQMVGQARQAGWEIGAQEVFRHQTLARLAAHARPVAAARAGAPEPLTGSVPLTPVQAW
FFRQDVKLRDHWNQWVEVRLPEGGDIAALREALCSALAHVVRHHDALRLRFSQRDGQWQA
CYVPPNAPDDLLWHAAMCDDVQLAECLARAQRSLSLAQGPLLRALLVRTAAGALRCYLMA
HHLVVDGVSWRILVEDLRTALAQIGAGGTVALPAVGQSMRAYAQHWHDWIRSDAAQAALD
AWRETLSDAVDTLGAAQPSQRQTGTAEIEYTWQASVTAPLMALRHVRMHEALTAAVAHAL
GTRTNAKRYVVHVEGHGREAVEGRGELSRTVGWFTAAWPLAVAVGETPLATLASARLAWR
AAPLGGASYGALRYLGTPHARQTLDALPQGRVTVNYLGRTDANVIVDGGLSHEPDAPPPN
ELTFDVWQADDALRVVCRYDRAFFTEPDVKSLVGAIESTLRTLAATAPGHEPVIAEDFPH
AGLSREQLATLPVALTQLDAIVPATSMQQGLLFYSQQQGAADPYFYQKGFVIDGDLDSRA
FAQAWRDIVVRHAALRSAYATDVGETPLLLVYASDTVAEADELVPSEDWRALTDIEQHAR
LDARLAAERAAGFPFLQAHRPRLALIRVSQARWWLLWSSHHVSLDGWSTGLILSDVMSRY
TELTKHRGTSADSGEAPSFAEFAIWQRERESDEAASLSHWRGLLDGVAGPTPLPLARRGG
ESALTRGHDEATWMLPAAQWHAWSEAARRAGVTPGTLCQGAWALLLARHADVRDVVFGVT
ASGRSAAVPGIERMAGLFINTLPVRAQLDPRQRVMDWLRQLQAQAAQSREHEHVALSTIA
RVAQREGEGADGALFESIVVFENYPLDTALLGERDDGLRLSLLDREPQARNNYPLSLIVE
QHDGLRLVLAYACERFDDESVVRLGERFIALLGTLADRLEAPLGAIGLRNESREGSESSE
STESNAASVSVARADWPTSDLLDDWHAHVARDGAALAAEGEDGRYSRDELDAAAHRLAVE
LQSRGMGPEDRVAVCLPRSAALLGAILGIWKAGAAYVPLDPAQPLARLEQLLKSSGAKAV
IVDDAAPALTQAPAIRWATFANAVDDAIPLAPVRTHPAQAAYVIYTSGSTGAPKGVVVSR
GALHNYAHAVTSRLCDGSLRRGVSEAGGFAVASTVAADLGHTTLFGALVLGRPLYLVPQA
CAFDAQRFAEWCGARPIDVLKIVPGHLKGLLDAGGEAVLPRAVLVTGGESFVPSLAAQIR
AVRPTLAMINHYGPTETTVGALTHVLPPVLTPDAAIPVGYPLANLRACVLDADLNPVPPG
VAGELYLGGAGVARGYLGAPGLTAERFVPDPNAVGARLYRTGDRAMRRDDGAFVYLGRLD
DQVKIRGYRVEPAEVANAMRAAPGVTGAAVVARHDGPGGAWLHGVFTGTATVDAVRAALV
AALPPAWVPARLDRLEVLPLTANGKLDRRALAVLGDNAHAAQATPGGAADDVPRAGAEAD
IAAVWCQVLKRERVGRNDAFFDIGGDSILALQVIARLRKRGLRIGPQHLASHPTIAQLAT
LSPSATTTAPAAATARDRSPASAGPVPGDPRRRTFPLSSSQMRVWLETQMAPRAGAYHIA
GALRLDGPLRADALARALDTLSDWHDALRTTIEVSDADGGVPQQRVHADMPVAYTFYTIA
PGLSAAEQDAAVQAKLDAFTREPFDLTEGPLWRVHWLRLDAHSHVLMLAMHHLISDGWSM
NLLIDDLARAYLAHADGGLPTREASASSLPPLRYGDYALWQREQLSGAAYAQQLAYWRDH
LGATHPELALPFDRAYPAIRDGAGDSVVLPIPPDLPARLERFAREHGATRFMVMTAAFHL
LMYRVTGEGDVRTGLPVVGRTHEALESVVGFFVNTQVLCSRIEASTSFASLVAQVRERLL
AAQQHGDVPFERLVEHLAPARSVSRHPLFQVTVNHQKRAFAPLRDLHGVSMRTIERRAHH
AQVDLALDTEEDETGALRGWLTYACDVFDAPTVRRLGEQWLTLLDAAMREPDAPAARLSM
AGDAWLAQQATRERAAVATPTPVHQVIDVQAAERGDAVAVRDAGTELSYAALVARANRVA
HALLRAGVRPEARVGIAMSRGVDLIVAMLGVLKAGAAYVPLDPTYPAERLSYMVADAGVT
LAITQEALTGQVWLPEDAITLESVLADETLSDRAPAVAVHADQLAYVIYTSGSTGRPKGA
QLTHRNLMRLLLGTSGDFAFDASDVWTMFHSYAFDFSVWEIFGALVHGARLVVVSHDTAR
DPAAMWALVLREGVTVLNQTPSAFYQWLGAMPPDVVSTTLRHIVFGGEALAPARLHPWWA
RFGDATRLTNMYGITETTVHVSRRVLRPGDMAGSPIGEPIADLDWRVLDAGLNEVPPGVA
GDLYVCGAGLARGYLGQPGLTAERFVPDPKGAPGERMYRSGDRARRLADGTLDYLGRGDA
QVKLRGFRIEPGEIEAQLLQHADVTDAAVLVRDDGAGEQLVAYVVSAQDAAALWPRLREH
LAGRLPAYMVPGQWLRLDALPLTPNGKLDRRALPAPQAAGAADFEAPHAGVESLIASVWQ
DVLGVSRVGRQDDFFALGGHSLLATQVASRLRDALAVEVPLRTLFEASVLSALAQALTAL
TEATPVRPAAIGDAVQDALREIESLSPEALQALLDSEARH
NT seq 13263 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgctttccgtttgcccgtgccgttcggcccgtcctccgccgcgtcctccgac
gctcccatcgaaaccatcgtcgacctgttgcgcgcccgcgcccgtctcgaacctgaacgc
gaggcgctgcgcgcggtggcaagcgacgagggcgacggccaggcgctcagttgcgccggg
ctcgacgcccgcgcgcgtgccgtcgcggcgacgctgcagcgtcttgcggatggccgggcg
cacggcgagcgcggactgttgctcatgccgaccggcctcgactacgtgacgggatttttc
ggctgcctgtacgcgggcgtgatcgcggtgccggcgttcccgcccgagtcggcgcgcccg
cagcatctcgcgcgagtgcggtcgatcctgagcgacgcgcgtgcgcgcttcgtcctcacc
gatcagcgccatcgcgacgccatgctggccttcggcgatgcggtgcccgagctgcgcggc
gtggagatcgtcgtgatcgacgagatcgaggaaagtcaggccgacgcctggcagccgacg
gccatcgcgcccgccgacctcgcgttcctgcagtacacctccggctcgaccgccacgccg
aagggcgtgatggtcagccacgccaatctcatggcgaacgaggcggccatcgtggcaggg
ctgggcatgacgtgcgacgacaccatggtgagctggctgccgctgtatcacgacatgggg
ctcatcggcggactgctctcgccgatctatcgcggcgcacgcctcgtgctgatgtcgccg
cagttcttcctggagcgtcccgtgcggtggctgcgcgccatcgaccgcttcggcggcacg
gtcagcggtggccccgacttcgcctaccggctgtgcgcgcagcgtatcgatgccgccacc
atcgccggcttgaagctcgacggctggcggctggcattctccggctcggagccggtgcgg
cacgacacgttgacggacttctgcacggcgttcgcgcccgcgggcttctcgcctgccgcc
gtgtatccgtgctacgggctcgcggaggcgacgctcttcgtcacgggcgggcggcgcggc
gatggcatgacggccaccgcgttcgaccggggcgcgctcggacagcagcgcgcgagggcc
ggcggcgatgacgtggcgatgctcgtcggctgtggcgtcgcgccggccgaccacgaggtg
cgcctcatgacgtggagcgatgcacccgacgcggtacccggcccggtcgacgccggcggc
acgggagaaatctgggtgagcggatcgagcgtcgcgcaaggctactggcacaacgagaca
gcgagcgcgcgcactttcgtgcaggcggacggcaagcgttggctgcgcacgggcgatctg
ggtttcatgcacgacggccaactgtacattaccggccggtgcaaggacgtcatcatcgtg
cgtgggcacaacctgtatcctcaggatctcgagaaggcggtcgagacggacgtcgaactc
gtgcgcaaggggcgcgtgacggcttttgctgtcgacatcgacggcgagccgggtatcggc
atcgcggcggaggtcggccgcagcgtgcagaagatggtgttgccgcggacgctggcggaa
gcggtcgccgtcgcggtggcggatgcctgtcagcaggcgccgtcggtggtggtgctgctc
aatccgggcgcgttgccgaagacgtcgagcggcaagctccagcgaagtgcctgcgcccaa
ggctggcgcgacggcgcgctcgatgcgtggtccacctggcagaacggcgtggtgctcggg
gacctcgggaacggcatggcgaaagcgcaagccaatacgtcggccgccatggagaacggc
acggcggctgccgaggccgatcctcgttacgaggcggtggcggcgatctggcgggaagtc
ctgggccgcgcgacggtgaagcccgacgatcatttcttcctgtgcggcggcagctcgctg
cttgccatgcaggtccttgcccgcgtgcatgaacggctgggtgtgcgcgcgacgcccgct
tcgctgtacgagcatgcgcgcctgggcgattgggtgcgggcgctggcggagctgtcgccc
gagtccagcgaccacgccgacgtatcggcgttgcgcattccggtggcgacgccgctctcg
cagacgccgcatgaacgcgtctaccgccagtcgtttgcgcaggcaagactgtggttccaa
catcggctcgatccggcgaacagcgcagcgttccacgtgggtgggcaactgcgggtcgaa
ggaccgttcgaggtcgcaacgtttgcccaggcgctcggtgcggtagtggcacgtcacgac
gcgctgcgcacgaccttcggcgaacgcgacggcgtcgccgtgcagattgcaaatacgcgt
gtcgacttaccgctcgtccagcacgacgtcgccggcgaggcggagcctgccgcggtggct
ggacgattgaccgaagcggcgttgaccgaacctttcgcgcccgagacgtcgccgccatgg
cgcgtcctggcgttgcgtatcgcaccgaacgaacatcgtctggtgttcgtcctgcatcat
ttgctgaccgatgcgtggtcgatgacgctgctcgtcgacgaactcgcgcaggcctatggc
gcaattgcggcaggcacggcgcctgcattcggcgccagcgtcctgcaacccggcgaccac
gctcactggcagcgcgcgcgcctcgacgaggcgacgctcggccgtcagctcgattggtgg
caggcgcgtctgccagagccctcgccggtgttggcactgccggtcgaccgtgcgcgcggc
gcgacgcgcggcagcgcgggggcaacgcacgcgctcgatttccccgccgggctcacccga
aatctgcgcgagtatgcagcacagcgcaaggtcacgcccttcgtcgtgctggccgcgtcg
ttccagtggctgttgcatcgctacgcgggcgagtcggacgtccgcgtcggggtgccggtc
gcgcatcgcgacgtggctgggctggagcgcatgctcggctgcctcgtcaatacgcaggtc
tggcgcgcgcagatcgacccggcgggcgacttcgacgcgctggttgcccaggttcgcgac
ggcgcgctcgacgcgcaggcccatcgcgacgcgcctttcgagcgcgtggtcgaacgtatc
gcaccgcagcgcagcctcgggcactcgccgctgtttcaggtgatgctcaaccaccacacg
gccaacgcggcggcccgtcgcgagattgccggctggccggcaggactcgccgtgagcgca
cagccgctgacaggcggtgcgcagtacgatctcgctctggacatcgacgagtggcacgac
gcggcggcaaccgatccgctcgacggcgtgacattgcgcgcgcggctcacgtttcctacc
gacctcttcgacgttgcgaccatcgagcgcatggggcgggactggctgaccggcctcgcg
gcattgctggcgctgcccacgcgcgcgctggcgtcgctcgacgttgcattcgcacccgcg
gagaacgacacgcaccgtgcggtgcgtcttccggccggcgtggcgttccggagcgtgccg
gcgcgcatcgacgcgcaagcccagcgccagccggcggccatcgcgttgcgcgacgaagcc
ggcacgttgacgtacgccggactggtcgccgcatccaaccggatcgcgcactggctgcaa
gcgcagggcgtcgctccggaggcgcgcatcggtctggccatgacccggcagacgggcatg
atcgcgggcctgctgggcatcatgaaagcggggtgcgccttcgtgccgctcgatccggcc
tatccggccgagcgtctcgcgcagatcatcgacgacgcgggcattgcgttggtactcacc
gagacatcgctgtcgcaggcgttctggcagcccgcgcggcggggcatcgtcgcggacatc
gtcgccgacacctcgttgcccgggcaggcaacgacgaccgcgttgcgcgccgatcaactg
gcctatctcatctatacgtccggttctacgggcgtgcccaaaggcgtggccgtcgagcat
ggcccgctcgcgatgcactgtgccgcgaccggcgagcaataccgactgagcccggaagtg
tgcgaactgcatgtgctgtcgatcaacttcgatggggcgcacgaacggtggatggcgccg
ctcgctttcggcgcgtcgctgttcatcgccgacgagcggcactggacgccgcagacgatg
gtcgacgccatgcgccgtcacggcgtcaccaacgccggttttccgacggcctatctgtgc
cggctcgcgacaagcggggcgactggcgcccccgcgctgcgcctgctctcgttcggcggt
gaagccatgccgttgcccgcgctgcgtgccgcacaggcgatgttccggccggcgcagacc
atcaacggctatgggccgaccgagacggtgatgacgccggtggcctggtccatcgacggc
gacctggacgcccagccggcggcgggcgtggccggacaggcttacgcgcccatcggcgaa
ccggtggggaatcgccgcgcgtgggtactcgatccgtggctgggtgaggtgccgctcggg
gcggtcggagagttgtatctgggcggcgagggggtagcgcgcggctatttcgaccggccg
gggctgacggcggagcgcttcgtgccggacccgcgcggcgagccgggcgcccgaatgtac
cgcactggcgaccgcgtgcgacgccttgccaacggcgcactcgtgtacctcggccgcttc
gatcagcagatcaaggtgcgtggattccgtatcgaaccgggcgaggtcgagacgcagttg
ctgcgcgaagcgggtgtggacgacgctctggcagtcgtggcggccggccccgccggcgac
cagctcgtggcttacgtcgcgggccgggggctcgatggcgaggccttgcgcgacgccttg
gcgaatcgattgcccgactacctggtgcccgcgctcgtcatggtgctcgacacgttgccg
aaactgcccaacggcaagcgggaccgcgccgcgctgcccgcgccggtgtggggcagcacg
ggcggacaggcgcccgagagcgccgctgagcgggcgcttgcggcgatctggcaaacgctg
ctgcgccaacccgccgtgagccgtgacgacaacttcttcgcgctcggcggcgactccatc
gtggcgctgcagatggtcggacaggcacggcaggccggttgggagatcggtgcgcaggag
gtctttcgtcatcagacgctggcgcggcttgcggcacatgcccgtcccgtggcagcggcg
cgcgcaggcgcccctgagccgctgacgggcagcgtaccgctcacgcctgtgcaggcatgg
ttcttccgtcaggacgtcaagttgcgcgatcactggaatcaatgggtcgaggtgcggctg
ccggaagggggcgatatcgctgcactgcgcgaagcactgtgcagcgcgctcgcgcacgtt
gtgcgacaccacgatgcgttgcgcctgcgattttcgcagcgcgacggtcaatggcaggcc
tgctacgtgccgcccaacgcgccggacgatcttctttggcacgcggcaatgtgcgacgac
gtccaactcgccgaatgccttgcgcgggcgcagcgcagcctctcgctcgcgcaaggcccg
ttgctgcgcgcgctgctcgtgcgcacggcagcgggcgcgttgcgttgctatctcatggca
caccatctggtggtcgacggtgtctcgtggcgcatcctggtggaggacctgcgaaccgcg
ctggcacagatcggcgcgggagggaccgtcgcgttgcctgccgtcggtcagtccatgcgc
gcgtacgcgcaacactggcatgactggatacgcagcgacgcggcacaggccgcactcgat
gcatggcgcgagacattgtcggacgcggtcgacaccctcggcgcggcacaaccttcgcaa
cggcaaaccggcactgccgagatcgaatacacgtggcaggccagcgtgacagcgccgttg
atggcgctgcggcacgtgcgcatgcacgaagcgttgacggccgccgtggcgcacgcgctc
ggcacgcgcaccaacgcgaaacgctatgtcgtccacgtcgaaggacatgggcgcgaggcc
gtggaaggacgcggcgagctctcgcgcacggtgggttggttcacggccgcatggccactg
gccgtcgccgtcggggagacgccgcttgccacactggcatcggcacgcctcgcctggcgc
gccgcgccgctgggcggcgcgagctatggcgcgctgcgctatctcggcacgcctcatgcg
cggcaaacactcgacgcgctgcctcaagggcgcgtcacggtgaactatctcggccgcacc
gacgccaacgtcatcgtcgatggtggcctgtcgcacgagccggacgcccctccgccgaac
gagttgacgttcgacgtctggcaagctgacgacgcgttgcgggtggtctgccgctacgat
cgggcattcttcaccgagcccgacgtcaagtcgctcgtcggcgccatcgaatcgacgctg
cgcacactggcggcaacggcgcccggccatgagccggtcatcgcggaggacttcccgcac
gcaggactttcgcgcgagcaactggcaacgctgccagtcgcgttgacccagcttgacgcc
atcgtgcccgcgacgtcgatgcagcaaggtctgctgttctattcgcagcagcagggcgcc
gccgatccgtatttctatcagaagggtttcgtgatcgacggcgatctcgactcgcgtgct
tttgcgcaagcgtggcgtgacatcgtcgtgcggcatgccgcattgcggagcgcctatgcc
acggatgtcggcgagacgccgctgttgttggtgtacgcgagcgacacggtggccgaggcg
gacgaactcgtaccgtccgaagattggcgagcactgactgacatcgagcagcacgcgcgg
ctcgacgcgcgtcttgcggcggagcgcgctgccggattcccgttcctgcaggcgcatcgg
ccccgtctggcgttgatccgcgtttcgcaggcgcgctggtggctgttgtggagcagtcac
cacgtgagtctcgacggctggagtaccgggctgatcctgagcgacgtgatgtcgcgatac
accgaactcacgaagcatcgtggtacgtcggccgacagcggcgaggcgccgtcgtttgcc
gaattcgcgatttggcagcgcgagcgggagagcgacgaggcggcctcgctgtcgcattgg
cgcggtctgctcgatggcgtcgccgggccgacgccattgccgctggctcgccgtggcggt
gagtcggcgctcacacgtgggcatgacgaagcgacctggatgctgcccgccgcgcagtgg
cacgcgtggagcgaagcggcgcgccgcgcaggtgtgacgccgggcacgctgtgtcagggg
gcatgggcgctgctgctcgcgcgccacgccgatgtgcgtgacgtggtgttcggcgtgacg
gcgtccggtcgctcggcggccgtgcccggcatcgagcgcatggccgggctgttcatcaat
acgctgcccgtccgtgcgcagctcgatccccgtcaacgggtaatggactggctgcggcaa
ctgcaggcgcaggccgcacagtcgcgcgagcatgagcatgtcgcgttgtccacgattgcc
cgtgtggctcagcgtgaaggcgagggggcggacggtgcgctgttcgagagcatcgtcgtc
ttcgaaaactatccgctggataccgctctgctcggcgagcgcgacgacggcttgcggctg
tcgttgctcgaccgcgagccgcaggcccgcaacaactatccgctctcgctgatcgtggag
cagcacgacggcttgcgcctcgtgctcgcctacgcgtgcgaacgcttcgacgacgagagc
gtggtgcggctgggcgagcgattcatcgcgctgcttggcacgttggcggatcggctggag
gctccgctgggcgcgattggcctacgtaatgaaagcagagaaggcagcgaaagcagcgaa
agcaccgaaagcaacgccgcgagcgtgtcggttgcccgcgccgattggcccacgagcgat
ctgctcgacgactggcacgcccatgtcgcgcgcgatggcgcggcgctggccgccgaaggc
gaggacggtcgctacagccgcgacgaactggatgccgccgctcatcgtctggccgtcgaa
ctgcagtctcgcggcatggggccggaggatcgcgtcgcggtgtgcctgccgcgcagcgca
gcgctgctcggagcgatcctcggcatatggaaggcgggcgccgcctacgtgccgctcgat
cctgcgcagccgcttgcacggctcgaacaactcctgaaatccagtggcgcaaaggccgtc
atcgtggacgacgcggcgccggccttgacgcaagcgccagccattcgctgggcgacgttc
gcgaatgctgtcgatgacgcgatcccgctcgccccagtgcgtactcaccccgcacaagcg
gcttatgtgatctacacgtcggggtcgacgggggcgccgaagggcgtggtggtcagtcgc
ggcgcgctgcataactatgcgcatgcggtgacgtcgcgtctgtgcgacggcagcctgcgc
aggggcgtgagcgaggccggcggttttgccgtcgcgtcgacggtcgccgccgacctcggg
cataccacgctgttcggtgcgctggtgctgggccgcccgctctacctcgttccacaggcg
tgcgcattcgacgcgcaacgcttcgccgagtggtgtggtgcgcggcccatcgacgtcctc
aagatcgtacccggccacctgaaagggctgctcgacgcgggcggtgaagccgtgttgccg
cgcgccgtgctggtcaccggcggtgagtcgttcgttccgtcgttggcggcacagattcgc
gcagtgcgcccgacgctcgccatgatcaaccactacggtccgacagagacgaccgtggga
gcgctcactcacgtcttgccgccggtgctcacgcccgacgctgccattccagtcgggtat
ccgctcgcgaacctgcgtgcctgcgtactcgacgccgacctcaatccggtgccgccgggc
gtggcgggcgagctctatctcggcggcgcgggcgtcgcccgtggctaccttggcgccccc
gggctgacggccgaacgattcgtgcccgatccgaacgcggtcggcgcgcgtctttaccgc
accggcgaccgggcgatgcggcgcgatgacggcgccttcgtctatctcggccgcctggac
gatcaggtcaagattcgtggctatcgcgtggagcctgcggaggtggcgaatgccatgcgt
gccgcgccgggcgtcaccggggcggcggtggtggcgcgccacgacggcccgggtggggcg
tggctgcatggtgtcttcacgggaacagcgacggtcgatgccgtgcgagcggcgctcgtg
gccgcgttgccgcccgcgtgggtgcccgcgcgtctcgacaggctggaggtactgccgttg
acagccaacggcaagctcgaccggcgtgcgctcgcggtgttgggcgacaacgcgcacgcg
gcgcaagccacgccgggtggcgcggcggacgatgtgccgcgagctggcgcggaagccgac
atcgcagccgtctggtgccaggtgctcaagcgcgagcgcgtaggtcgcaacgatgccttc
ttcgacatcggcggcgattcgattctggcgttgcaagtgattgctcgcctgcgcaagcgc
ggcctgcggatcgggccgcagcatctcgcctcgcatccgacgatcgcgcaactcgcgacg
ctttcgccctcagcgacgacgacggctccggcagccgcgacagcgcgggaccgctcgccg
gcgtcggcaggtcccgtccctggcgatccgcggcgacgcacgttcccgttgtcgtcgtcg
caaatgcgtgtgtggctggaaacgcagatggcgccgcgcgcgggggcgtatcacatcgcc
ggcgcgctgcgtctggacggtccgttgcgggctgatgcgctggcgcgcgcgttggacacg
ctctcggactggcacgatgccttgcgcaccaccatcgaagtgagcgacgccgacggtggc
gtgccgcagcagcgagtgcacgccgacatgccggtcgcctacacgttctacaccatcgca
ccgggcctgagcgcggccgagcaggacgccgcggtgcaggcgaaactcgacgcattcacg
cgtgagccgttcgatctgaccgaggggccgctctggcgagtgcactggcttcggctggac
gcccattcgcacgtgctgatgcttgccatgcatcacctgatctccgacggatggtcgatg
aacctgctgatcgacgatctcgcgcgtgcctaccttgcccatgccgatggggggctcccg
acgcgcgaggcgtccgcgtcgtcactgccaccattgcgttatggcgactacgcgctgtgg
cagcgagagcaattgagcggcgccgcatacgcgcagcaactggcgtattggcgcgaccac
cttggcgccacacacccggaactggcgctgccgttcgatcgcgcgtatcccgcgatccgc
gacggtgccggcgacagcgtcgtgctgccgatcccgccggatctgcctgcccgcctcgaa
cgcttcgcacgcgagcacggggcgacgcgtttcatggtgatgaccgccgctttccatctg
ctcatgtatcgcgtgaccggcgagggcgacgtgcgcaccggcctgccggtggtcggacgc
acgcacgaggcgctggaatccgtcgtcggcttcttcgtcaacacgcaggtcctgtgctcg
cgcatcgaggcctcgacctcgtttgcctcgcttgtcgcgcaggtgcgcgagcggctgctc
gcggcgcagcaacacggcgacgtgccgttcgagcgtctggtggagcatcttgcgccagcg
cgcagcgtgtcgcgacatccactgttccaggtcaccgtcaatcatcagaagcgggcgttc
gcaccgctgcgcgatcttcacggtgtctcgatgcggacgatcgagcggcgggcgcatcac
gcccaggtcgatctcgcgctcgataccgaggaagacgaaacgggtgcactgcgcggctgg
ctgacttatgcctgcgatgttttcgatgcgccgacggtgcgtcgcctgggcgagcaatgg
ctgacgttgctcgacgccgcgatgcgcgagcccgacgcaccggccgcgcgtctgtcgatg
gccggcgacgcttggctcgcacaacaggcgacgcgcgagcgggccgccgtggcgacgccc
acgcccgtgcatcaggtcatcgatgtgcaggccgccgagcgcggcgacgccgttgccgtg
cgcgacgccgggaccgaactctcgtatgccgcgctggtggcgcgcgccaatcgcgtggcg
cacgcgctgcttcgcgccggcgtgcgaccggaggcgcgcgtgggcatcgcgatgtcgcgc
ggcgtcgatctgatcgtggcgatgctcggcgtgctcaaggctggcgcggcttacgtgccg
ctcgatccgacgtaccccgccgagcgcctgtcgtacatggtcgccgacgccggcgtcacg
ctcgccatcacgcaagaggccttgactgggcaggtgtggctgcccgaggacgccatcacg
cttgaatccgtgcttgccgacgaaacgctgtcggatcgcgcgcccgcggtggccgtccat
gccgaccaactggcctatgtgatctacacgtcgggctcgacgggccggccgaaaggcgcg
cagctcacgcatcggaacctgatgcgcttgctgctcggcacgtcgggcgattttgcgttc
gacgcgagcgacgtgtggacgatgttccactcgtacgcgttcgacttctcggtgtgggaa
atcttcggtgcgctcgtgcatggcgcgaggctcgtcgtggtgtcgcatgacaccgcgcgc
gatccggccgcgatgtgggcgctcgtccttcgcgagggcgtcaccgtgctcaatcagacg
ccgtcggcgttctatcaatggctcggtgcgatgccgcccgacgtggtttccacgacgctg
cgccacatcgtgttcggcggggaagcgcttgcacccgcccggctgcacccgtggtgggcg
cggttcggcgatgcgacccgcctgaccaatatgtacggcatcacggagacgaccgtgcac
gtcagtcggcgcgtactgcgccccggcgacatggccggttcgcctatcggcgagccgatt
gccgatctcgactggcgcgtgctcgacgccgggctcaacgaagtgccgccgggcgtggcc
ggcgatctgtacgtgtgcggcgccggtctcgctcgcgggtatctcgggcagccggggctc
acggcggagcgtttcgtccccgatcctaagggggcgccgggcgagcgcatgtatcgcagc
ggcgaccgcgcgcggcgactggctgacggtacgctcgactatctcggtcgcggcgacgcg
caagtgaagctgcgcggtttccgcatcgaaccgggcgagatcgaggcgcaactgctgcag
cacgcggacgtgaccgatgccgcggtgcttgtgcgcgacgacggggcgggcgagcaactg
gtggcgtacgtcgtgtccgcgcaggacgcggcggccctctggccgcgcctgcgcgagcat
ctcgccggacgcctgcctgcgtacatggtgccggggcagtggctgcggctcgatgcgctg
ccgctcacgcccaacggcaagctcgaccgccgggcgctgccggcgccgcaggcagccggc
gcggcggacttcgaggcgccgcacgccggtgtggagtcgctcatcgcctcggtctggcag
gacgtactcggcgtgtcgcgcgtgggccgccaggatgacttcttcgccctgggcggccac
tcgctgcttgccacgcaggtggcgtcccgtctgcgggatgcgctggccgtcgaggtgccg
ctgcgcacgctgttcgaagcgagcgtgctcagtgcgttggcgcaagcgctcacggcgttg
accgaagctacgccggtgcggccggcggcgatcggcgacgccgtgcaggacgcactgcgt
gaaatcgaatccctttctcccgaggcgttgcaggcgctgctcgattcggaggcacgacac
tga

DBGET integrated database retrieval system