KEGG   Pseudomonas putida NBRC 14164: PP4_15280Help
Entry
PP4_15280         CDS       T02707                                 

Definition
(GenBank) pyoverdine synthetase
Organism
ppun  Pseudomonas putida NBRC 14164
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1763841..1776794
Genome map
AA seq 4317 aa AA seqDB search
MTDAFELPLSLVQALAQRAAQTPDKIALRFLADAPGEQAVLSYRDLDQRARTIAAALQAR
AGFGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESARQHHQERLLSIIDDAEPRLL
LTVAALHGSLQGLEALAADNGPELLAVDGLDPALAADWREPALQGDDIAFLQYTSGSTAL
PKGVQVSHGNLVANEQLIRQGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVL
MSPGYFLARPQRWLQAISEYGGTISGGPDFAYRLCSERVSEASLAGLDLSRWRVAYSGSE
PIRQDSLATFADKFRACGFDPQSYFASYGLAEATLFVSGSRRGQGIAALELDAEAFAANR
AEPGKGSVLMSCGYPQPGHAVRIVEPQHLQVLGDNQVGEIWAGGPSIALGYWRNPEASAR
TFVEMDGQTWLRTGDLGFMRDGEVFVTGRLKDMLIVRGQNLYPQDLEKTLEREVEVLRKG
RVAVFAVEQQGEEGIGVAVEISRNVQKAIKPQDLIKTLRQVIADACRQAPAVVLLLNPGA
LPKTSSGKLQRSACRLRMDDGSLDCYARFPDVSEAAASAAGGDELQTRIAAVWRDILKLE
AVAADDHFLLLGGNSIAATQATARLADELGINLSLRTLFEVPVLADYSNAVASIIAEGAA
GTATIATLERAQALPQSLAQNRLWLTWQLQPQSAAYNIPAGLQLRGELDESALEAAFQML
VVRHESLRTVFCEENGLALQRILPHQPFSLRRLGLEGQTPEQVSAAREAEARQPFDLTQG
PLLRVTLARLDDEHHQLWVTLHHIVADGWSLNILLDEFAKLYAARCQGLGASLAPLTLGY
ADYGTWQRQWLAAGEAERQLQYWKAQLGDELPVLDLCTDHPRASQRGYGAARFNLKVPAK
LAEALKGLAREQQASLFMVLLAGWQALLHRYSGQADIHVGVPNANRPRLEAQGMVGFFIN
TQVLCAQLDGRLPFAQLLAQVRQATLEAQANQDLPFEQLVEALPEAREQGLFQVMFNHQQ
RDLSALRRLPGLLAEELPWHSREAKVDLQLHSEEDHQGRLSLAFDYAAELFEASTVKRLA
HHLLALLEQVCGAPQRPLGEVQLLDEPGRAQLLGWGRAPAAAPPSLLVEQLNEQARRTPQ
RTALAWDGGSLDYAELHQQANRLAHYLRDKGVGPDTCVAIAIERSPQLLVGLLAILKAGG
AYVPLDVDYPAERLAYMLADCNAGLMLSHSSLLGKLPQVDGVSAIAIDQLHLDSWPSQAP
GLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQATYALNDSDVLMQKAPISFD
VSVWECFWPLVTGCKLVLAGPGEHRDPQRIAALVQAHGVTTLHFVPPLLQVFAQEPQAGA
CSSLRRVFSGGEALPAALRGRVLQVLPQVQLHNRYGPTETAINVTHWHCQAEDGERSPIG
RPLGNVLCRVLDDELELAAPGVPGELYLGGAGLARGYLGRPGLTAERFVPQADGHGERLY
RSGDRARWQVQLEALEYLGRLDQQVKVRGFRVEPEEVQACLLAQPGVEQALVLIHKDAVG
AQLVGYYSGSAQPAEVLAVLAEQLPAYMVPAQLIPLAQLPLGPSGKVDRKALPAPVWQQR
EHVEPHTELQQQVAAIWREVLNLPRVGLQDDFFALGGHSLLATQIVSRSRQACDVELPLK
ALFEASELGAFCAEIARIRAAGERNLQGAIARVDRRQAVPLSYSQQRMWFLWQMEPDSPA
YNVGGMARLRGTLHVDAFERALQALIVRHETLRTTFPSVDGVPYQCVAEDSGLHLDWQDF
SALPLDARQQHLQQLADDQAHQPFDLERGPLLRACLVKADEREHFFVLTLHHIVTEGWAM
DIFARELGELYEAFVDDRESPLAPLPVQYLDYSVWQRQWLESGEGARQLAYWKDRLGDEH
PVLALPADRPRPAVQSHRGELFRFELDPALVARVHAFNSQRGLTLFMTMTATLAALLHRY
SGQRDLRIGAPVANRIRPESEGLIGAFLNTQVLRCELDGQMTANALLEQMRQAAIEGQSH
QDLPFDQLVEALLPPRSSAYNPLFQVMCNVQRWAFQQSRTLAGMQVDYLLNDASATKFDL
YLEVTDLDGRLGCCLTYSRDLFDEPRIARMAEHWQQLLVSLLDNPQQRLCELPMLSSAEQ
QVLAGQLQGEQDFDLDQTLHGLFAAQAARTPQAGALTFAGQHMSYAELDQQANRLARALR
ERGVGPQVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLDRLRYMIEDSRIGLLLS
QRELLQTLGELPEGVARWSLEDDAASLSAYSDAPLDNLNLPQHQAYLIYTSGSTGKPKGV
VVSHGEFAMHCQAVIAAFGMRSDDCELHFYSINFDAASERLWVPLLCGARVVMRAQGQWG
AEDICQLVREQQVSILGFTPSYGSQLAQYLGGQGEQLPVRLVITGGEALTGEHLQRIRQA
FAPQQFFNAYGPTETVVMPLACLAPEVLPADLGSVPIGHVIGSRSAYILDEDLAVLPQGG
IGELYVGGAGLAQGYHDRPGLSAERFVADPFSAEGGRLYRTGDLVRLGTDGLVEYVGRAD
QQVKIRGFRIELGEIESRLQAHADVDEAVVLALDLPGGKQLVGYLLCKQATAGSEAQSQL
REAVKADARQHLPDYMVPAHLVLLDSLPLMGNGKLDRRALPLPDLEQARQQYQPPGNEVE
AQLAQIWRDVLNVARVGVQDNFFELGGDSILSIQVVSRARQAGLQFTPRDLFQHQTIQTL
AAVVRYSEAASSIEQGLRQGQTGLTPIQHWFFDSEVPQPQHWNQAVLLEARQPLDEAALG
QALAALVQHHDSLRLRFDEARGRWQAEYAQPDARQLLWTATVADFADCQALYTDLQRSLD
LQQGPLLRALLVRDGQGSQRLLLAIHHLVVDGVSWRVLLEDLQALYRGQPLPAKTHSMGD
WSARLASYAGSDSLRDELGWWQGQLGGVRRELPCDHPQGGNLHRHAQTLAIGLDVEQTRQ
LLQQAPAAYHTQVNDLLLTALARALSRWSGDEEVLVQLEGHGRDGLFEDMDLTRSVGWFT
NAYPLSLRPLPGEDDAARAGSIKRIKEQLRQVPHKGLGYGVLRYLGDTAGREQMAALPQA
RITFNYLGQFDQQFDSAALFQPLEAPAGLAHDLDAPLPNWLSVDGQVYGGALQLRWTFSA
ERYDPQTIARLAEAYRQELLALVAHCLADGNGSFTPSDFPLAHLTQEQIDALPVPAVQIE
DVFPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSALDPERFAQAWQAVVARHEALRASF
SWNSGEAMLQIIHKPGNLAVDYQDWRGLADDAQEQRLQALHKQEREAGFALLSEAPFHLR
LVRVADERYWFMMSNHHILIDAWCRSLLMNDFFEVYQALGEGRQAQLPVPPRYRDYIGWL
QRQGLDDARAWWQANLAGFERATAIPSDRPLRHDHAGSGMIVGDCYTRLEVSDGVRLREL
AQAHQLTVNTFAQAAWALVLARYSGDRDVAFGVTVAGRPVSMPQMQRTVGLFINSVALRV
QLPVSGERCSVRQWLQGLLQSNMELREYEYLPLVAIQECSELPKGQPLFDSLFVFENAPV
ETAVLDHAQHLNASSDSGRTHTNFPLTAVCYPGDDLGLHLSFDQRYFDYPTVERLLAEFK
RLLLALVQGFDGEVSALPLMGADEQRFLLEDCNRTERAYPLEQSYIAQFEAQVAAHPERT
VARCLEASYDYAGLNLAANRLGHALISAGVKVDQPVALLAERGLPLLGMIVGSFKAGAGY
LPLDPGLPAARLQSIIQLSRTPVLVCSAACAEQGRQLLGELDVAERPQLLVWEDTQASQV
ASHNPGIHSGPDNLAYVIYTSGSTGLPKGVMVEQRGMLNNQLSKVPYLALSNQDVIAQTA
SQSFDISVWQFLAAPLFGAKVEIVPNAIAHDPQGLLAHVQATGITVLESVPSLIQGMLAN
DHQALAGLRWMLPTGEAMPPELAAQWLQRYPQIGLVNAYGPAECSDDVAFFRVDAASTQG
SYLPIGTPTDNNRLYLFGEEQALVPLGAVGELCVAGTGVGRGYVGDPVRTALAFIPHPHG
AAGERLYRTGDLARQRPDGVLEYVGRIDHQVKIRGYRIELGEIEARLHEQAEIRDAAVGV
QEGVNGKHLVGYLVAHQGVAADATLLEQIKQRLRAELPEYMVPLHWGWFDSLPHNANGKL
DRKALPAIDIGGQHSQAYQAPRNELEEVLACIWADVLKAERVGVHDNFFELGGHSLLATQ
IASRVQKQLQLNVPLRAMFECSTVEELAEYVLGLQGSALDDDKVDRLSDLMAELEGL
NT seq 12954 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgccttcgaactcccgctctcgctggtccaggcactggcgcaacgcgccgcg
cagaccccggacaagatcgccttgcgctttctggccgacgcccccggcgagcaggccgtg
ctcagttaccgggacctcgaccagcgcgcacgcaccatcgccgccgccttgcaggcccgt
gccggcttcggcgaccgtgcggtgctgttgttccccagtggtccggactacgtggcggcg
ttcttcggttgcctgtatgccggggtgatcgcggtgccggcttacccgccggagtctgcg
cgtcagcatcaccaggaacgtttgctgtcgatcatcgacgatgccgagccgcgcctgctg
ctgacggtcgcggcgttgcacggcagcctgcaaggcctggaagcgctggcggcggacaac
ggccctgaactgctggcagtggacggcctggacccggcgctggccgcggactggcgcgag
cccgcgctgcaaggtgatgacatcgccttcctgcagtacacctctggctccactgcgctc
cccaagggcgtgcaggtcagccatggcaacctggtggccaacgagcagttgatccgccag
ggcttcggcatcgacctcaaccccgacgacgtgatcgtcagctggttgccgctgtaccac
gacatgggcctgattggcggcctgctgcagcccatcttcagcggcgtgccgtgcgtgctg
atgtcgccgggttacttcctggcccggccgcagcgctggttgcaggccatcagcgagtat
ggcggtaccatcagcggtggccccgactttgcctaccgcctgtgcagcgagcgggtcagc
gaggcctcgttggccgggctcgacctgagccgctggcgcgtggcttattccggctccgag
ccgatccgccaggacagcctggcgacgttcgccgacaagttccgggcctgcggcttcgac
ccgcagagctacttcgccagctacggcctggccgaagccaccctgttcgtcagcggcagc
cgccgtggccagggcatcgccgcgctggaactggacgccgaagccttcgccgccaaccgt
gccgagccgggcaaaggcagcgtgctgatgagctgcggctacccgcagcccggtcacgcg
gtacgtatcgtcgagccgcagcacctgcaggtgctgggcgacaaccaggtcggcgaaatc
tgggccggtggcccgagcatcgccctgggttactggcgcaaccccgaggccagtgcccgc
accttcgtcgagatggacggccagacctggctgcgcaccggtgacctgggcttcatgcgc
gacggtgaggtgtttgtcaccgggcgcctgaaagacatgctgatcgtgcgcggccagaac
ctgtacccgcaggacctggaaaaaaccctcgaacgcgaggtcgaggtgctgcgcaagggc
cgggtggcagtgtttgccgtcgagcagcagggcgaggagggcatcggcgtggcggtggag
atcagccgcaacgtgcaaaaggcaatcaagccccaggacctgatcaaaaccctgcgccaa
gtgatcgccgacgcctgccgccaggccccggctgtggtcctgttgctgaacccgggcgcg
ctgcccaagacctccagtggcaagctgcagcgctcggcctgccgcctgcgcatggacgat
ggcagcctggactgctacgcccgcttccctgatgtgagcgaagccgctgcaagcgcggct
ggtggcgatgaactgcaaacacgcatcgccgccgtgtggcgcgacatcctcaagctggag
gcggttgcagcagacgaccacttcctgctgctgggcggcaactccatcgccgccacccag
gccaccgcacgcctggccgatgagctgggcatcaacctgagcctgcgcaccctgttcgaa
gtgccagtgctggctgattacagtaacgccgtggcctcgatcatcgctgaaggcgcggcc
ggcaccgccaccatcgcaacgctggaacgcgcccaggccttgccccagtcgctggcgcaa
aaccgcttgtggctgacgtggcagttgcagccacaatcggccgcctacaacatcccggcc
ggcctgcaactgcgcggcgagctggatgaaagcgccctggaagccgccttccagatgctg
gtggtgcgtcacgaatccctgcgcaccgtattctgcgaagaaaacggcctggccctgcaa
cgcatcttgccgcaccagccgttcagcctgcgccgcctgggcctcgaaggccaaaccccc
gagcaggtcagcgccgcgcgtgaagccgaagcccgtcagccgttcgacctgacccagggc
ccgttgctgcgggtgaccttggcacgcctggacgacgaacaccatcagctgtgggtgacc
ctgcaccacatcgtcgctgacggttggtcgctgaacatcctgctggatgaattcgccaag
ctttacgcggcccgctgccagggcctgggggccagcctggcgccgcttaccctgggttac
gctgactacggcacctggcagcgccaatggctggccgccggtgaagccgagcgccagctg
cagtactggaaggcacagttgggcgatgaactgccggtgcttgacctgtgcaccgaccac
ccccgcgccagccagcgcgggtacggtgctgcgcggttcaacctcaaagtgcctgccaag
cttgccgaagccctcaagggcctggcacgtgaacagcaggccagcctgttcatggtcctg
ctggccggctggcaggcgctgttgcaccgctacagcggccaggccgacatccatgtcggt
gtgcccaatgccaaccgcccgcgcctggaagcccaaggcatggtcggcttcttcatcaat
acccaggtactgtgcgcgcagctcgatggccgcttgccattcgcgcagttgctggcccag
gtgcgccaggccacccttgaggcgcaggccaaccaggacctgccgtttgaacaactggtc
gaagccctgccggaagcccgtgagcaaggcctgttccaggtcatgttcaaccaccagcaa
cgcgacctgtcggccctgcgccgcctgccggggctgttagcggaggagctgccgtggcac
agccgcgaagccaaggttgaccttcagctgcacagcgaagaagaccatcagggccgcctg
agcctggccttcgactatgccgcagagctgttcgaagccagcaccgtcaaacgtctggcc
catcacctgctggccctgctggaacaggtgtgcggcgcgccgcagcggccgctgggcgaa
gtgcaattgctcgacgagcctggccgcgcgcaactgttgggctggggccgcgcaccggct
gccgcgccgccaagcctgttggtagaacagctcaacgaacaggcccgccggacccctcaa
cgcactgcactggcctgggacggcggcagcctcgactacgccgaactgcaccagcaggcc
aaccgcctggcccattacctgcgcgacaaaggcgtcggccccgacacctgcgtagccatt
gccatcgagcgttcgccacagttgctggttggcctgctggccatcctcaaggccggcggc
gcctacgtgccgctggacgtcgactacccggccgaacgcctggcctacatgctcgccgac
tgcaacgccggcctgatgctgagccacagcagcctgctgggcaagctcccgcaggtcgac
ggagtcagcgccatcgccattgaccagttgcacctggacagctggcccagccaggctccc
ggcctgcacctgcacggcgacaacctggcctacgtgatctacacctccggctccactggc
cagcccaagggcgtgggcaatacccatgcggcgctggccgagcgcctgcagtggatgcag
gccacctacgcgctgaatgacagcgatgtgctgatgcaaaaggcgccgatcagcttcgat
gtgtcagtgtgggaatgcttctggccgctggtaaccggctgcaagcttgtactcgccggc
cccggcgaacaccgcgacccgcagcgcatcgccgcgctggtacaggcccatggcgtgacc
acgctgcacttcgtgccgccgctgttgcaggtgtttgcccaggagccgcaggcgggcgcc
tgcagcagcctgcgccgggtgttctccggtggcgaagcattgcctgcggcgctgcgtggc
cgcgtgctgcaagtgttgccgcaggtgcagttgcacaaccgctatggcccgaccgaaacc
gccatcaacgtcacccattggcactgccaggcggaggacggcgagcgctcgcccatcggc
cgcccgctgggcaatgtgctgtgccgtgtgctggacgatgagcttgaactggccgccccc
ggggtaccgggcgagttgtacctcggtggcgcgggcctggcccgtggctatttgggccgc
ccgggcctcactgccgagcgcttcgtgccccaggccgacggccatggcgagcgcctgtac
cgcagcggcgaccgcgcccgctggcaggtgcagcttgaggccctggaatacctcggtcgc
ctcgaccagcaggtaaaggtgcggggtttccgcgtcgagccagaagaagtgcaggcctgc
ctgttggcacagccgggcgtggaacaggcgctggtgctgattcacaaggacgccgttggc
gcgcagctggtgggttactacagtggcagtgcacagccagccgaagtcttggccgtgctg
gctgagcaactgcccgcgtacatggtgccggcccagcttatcccgttggcacagctgccg
ctgggccccagcggcaaggtcgaccgcaaggcactgccggcaccggtgtggcagcaacgc
gaacatgtcgagccccacaccgagttgcagcaacaggtcgccgccatctggcgtgaggtg
ctgaacctgccgcgcgtcggcctgcaggacgacttcttcgccctgggcgggcactcgctg
ctggccactcagatcgtctcgcgcagccgccaggcctgcgatgtcgagctgccgctcaag
gcgctgttcgaagccagcgaactgggcgccttctgtgccgagattgcacgtatccgcgcg
gccggcgagcgcaacctgcaaggcgcaatcgcccgcgtcgaccggcgtcaggcggtgccg
ctgtcgtattcgcagcagcgcatgtggttcctctggcaaatggagccggacagcccggcg
tacaacgtcggcggcatggcacgcctgcgcggcaccctgcatgtggacgctttcgagcgt
gcgttgcaggcgttgatcgtgcgccatgaaaccttgcgcaccaccttccccagcgtcgac
ggggtgccgtaccagtgcgtggccgaagacagtggcctgcacctcgactggcaggacttc
agtgccttgcccctcgatgcccgccagcaacacctgcaacaacttgccgacgaccaggcg
caccagccgttcgacctggagcgcggcccgctgctgcgcgcctgcctggtcaaggctgac
gagcgcgagcatttcttcgtgctcaccctgcaccacatcgtcaccgaaggctgggccatg
gacattttcgcccgcgagctaggcgaactgtacgaagcctttgtcgatgaccgcgagtcg
ccgctggcgccgctgccggtgcaatacctggactacagcgtatggcaacggcaatggctg
gaaagcggcgagggcgctcgtcaactggcctactggaaggaccgcctgggtgacgagcac
ccggtgctggcgttgcctgccgaccgcccgcgcccggcagtacagagccaccgcggggag
ctgttccgctttgaactcgacccggcgctggtcgcccgcgtgcatgccttcaacagccag
cgcggcctgaccttgttcatgaccatgaccgccaccctggccgccttgctgcaccgctac
agcggccagcgtgacctgcgcattggcgcgccggtggccaaccgcatccgcccggaaagc
gaaggcctgattggcgcatttctcaatacccaggtgctgcgctgcgagctggatggccag
atgaccgccaacgcactgctggagcagatgcgccaggccgccatcgaaggccagtcgcac
caggacctgccgttcgaccagttggtggaagcgttgctaccgccgcgcagtagcgcttac
aacccgctgttccaggtgatgtgcaacgtgcagcgctgggctttccagcaaagccgcaca
ctggccggcatgcaggtggattacctgctcaatgacgccagtgccaccaagttcgacctg
tacctggaggtcaccgacctcgacggccgcctgggttgctgcctgacctacagccgcgac
ctgtttgacgaaccccgcatagcgcgcatggccgagcactggcagcagctgctggtcagc
ctgctagacaacccgcagcagcgcctgtgcgagctgccgatgctgagcagcgccgaacag
caggtgctggcgggccagttgcagggcgagcaggacttcgacctcgaccagaccctgcac
ggcctgttcgccgcccaggcggcccgcacgccacaggctggcgcgctgaccttcgccggc
cagcacatgagctatgccgagctcgaccagcaggccaaccgcctggcccgtgccctgcgt
gagcgtggcgtcggcccgcaggtgcgcgtgggcctggcactggagcgttcgctggaaatg
gtcgtcggcctgctggccatcctcaaggccggcggcgcctacgtgccgcttgaccccgag
tacccactcgaccgcttgcgctacatgatcgaagacagccgcatcggcctgctgctcagc
cagcgtgagctgttgcaaaccctgggcgagctgcccgagggcgtggcccgctggagcctg
gaggacgatgccgccagcctgtcggcctacagcgatgcgccgctggacaacctcaacctg
ccgcagcatcaggcttacctgatctacacctccggctccaccggcaagcccaagggcgtg
gtggtcagccatggtgagttcgccatgcattgccaggcggtcatcgccgcgttcggcatg
cgcagcgatgattgcgagctgcatttctattcgatcaacttcgacgctgccagcgagcgc
ctgtgggtgccgttgctgtgcggtgcccgtgtggtgatgcgcgcccaggggcagtggggc
gccgaggacatctgccagctggtgcgcgagcagcaggtgagcatcctgggctttaccccc
agctacggtagccagctggcgcaatacctgggcgggcagggcgagcaactgccggtgcgc
ctggtgatcaccggtggcgaagcgctgaccggcgagcacctgcagcgtattcgccaggcc
tttgcgccgcagcagttcttcaacgcctacggcccgaccgaaaccgtggtcatgccgctg
gcctgcctggcgccagaggtgttgcctgcagaccttggcagtgtgccgattggccatgtc
atcggtagccgctccgcctacatcctcgacgaagacctggccgtgttgccgcaaggtggc
attggtgagctgtatgtcggcggcgccgggctggctcaggggtatcacgaccggccgggc
ctgagcgccgagcgattcgtcgctgacccgttcagcgccgaagggggccgcttgtatcgc
acgggcgacctggtgcgcctgggcactgacggcctggtcgagtacgtcggccgtgccgac
cagcaggtgaaaattcgcggtttccgcatcgaactgggcgagatcgagagccgcttgcag
gcgcatgccgatgtcgacgaggccgtggtgctggccttggatctaccgggcggcaagcag
ctggtgggttacctgttgtgcaagcaggccacggctggcagcgaggcgcaaagccagctg
cgtgaagcagtgaaggccgatgcccgccagcacctgccggattacatggtgccggcgcat
ctggtgttgctcgacagcttgccgctgatgggtaacggcaagctcgaccgccgtgcgctg
ccactgccagacctggagcaggcgcgtcaacagtaccagccccccggcaacgaggtggaa
gcgcaactggcgcagatctggcgcgacgtgctcaacgttgcccgggtaggggtgcaggat
aacttcttcgaactgggcggcgactcgatcctgtcgatccaggtggtcagccgggcccgt
caggccggcttgcaattcaccccgcgcgacctgttccagcaccagaccatccagaccctg
gcggccgtggttcggtacagcgaagccgcgagcagcatcgagcagggcttgcgccaaggc
cagaccggcctgacgccgatccagcactggttcttcgacagtgaagtgccacagccgcag
cactggaaccaggcggtgctgctggaagctcgccaaccattggatgaggccgcgcttggc
caggcgttggctgcactggtgcagcaccacgacagcctgcgcctgcgcttcgacgaggcc
cgtggccgctggcaggccgaatacgcccagcctgacgcgaggcaattgctgtggaccgcc
accgtggccgattttgccgattgtcaggcgctgtataccgacctgcagcgcagcctcgac
ctgcagcaaggtccgctgctgcgcgccttgctggtgcgtgacgggcagggcagccagcgt
ttgttgctggcgatccatcacctggtggtcgatggcgtgtcctggcgggtgctgctggaa
gacctgcaggcgctttaccgtggccaaccgctaccggccaagacccacagcatgggcgac
tggtccgcgcgcctggccagctacgccggcagcgattcgctgcgcgacgaactgggctgg
tggcaaggccagctgggcggcgtgcgccgcgaactgccgtgcgatcacccccagggtggc
aacctgcaccgccacgcccagacactggccatcggccttgacgtggagcagacccggcaa
ctgctgcaacaggccccggccgcctaccacacccaggtcaacgacctgctgctgaccgca
ctggcacgtgccttgagccgctggagcggcgatgaggaagtgctggtgcagcttgaaggc
cacggccgtgacgggctgttcgaagacatggacctgacccgcagcgtcggctggttcacc
aacgcctatccgctgagcctgcgcccgctaccgggcgaggacgacgcggcgcgggccggt
tccatcaaacgcatcaaggaacaactgcgacaggtgccgcacaagggcctgggctacggc
gtactgcgctacctgggcgacacggccgggcgcgagcagatggcggccttgccgcaggcg
cgtatcaccttcaactacctgggccagttcgaccagcaatttgacagtgcggcgctgttc
cagccactggaggcaccggccggtctggcgcatgacctcgacgcaccgctgccaaactgg
ctgagcgtcgatggccaggtgtacggcggcgccttgcaactgcgctggaccttcagcgcc
gagcgctatgacccgcagaccatcgcccgcctggccgaggcctatcgccaggagttgctg
gcgctggtcgcgcattgcctggccgatggcaacggcagcttcaccccgtcggacttcccg
ctggcgcacctgacccaggagcagatcgacgcattgccggtaccggctgtgcagatcgag
gacgttttcccgctgacgccaatgcaggaaggcatgttgctgcacaccctgctggagccg
ggcaccggcctctactacatgcaggaccgctaccgcatcaacagcgccttggaccctgaa
cgtttcgcccaggcctggcaggcggtagtggcgcgccacgaagcgttgcgcgcctcgttc
agctggaacagcggcgaggcgatgctgcagatcatccacaaaccgggcaacctcgcggtg
gactaccaggactggcgcggccttgctgacgacgcccaggagcagcgcctgcaagccctg
cacaagcaggagcgcgaggccgggtttgccctgctcagtgaagcaccgttccacctgcgc
ctggtacgcgtggccgacgagcgctactggttcatgatgagcaaccaccacatcctgatc
gatgcctggtgccgctcgctgctgatgaacgatttcttcgaggtctaccaggccctcggc
gaaggccgtcaggcccagttgccggtgccgccgcgttaccgcgattacatcggctggttg
cagcgccagggcctggacgacgcacgcgcctggtggcaggccaacctggccggcttcgag
cgcgccacggccatccccagcgaccgcccgctgcgccatgaccacgccggtagcggcatg
atcgtcggcgattgctacacccgcctggaggtaagtgatggcgtgcgcctgcgcgaactg
gcccaggctcaccagcttaccgtcaacaccttcgcccaggcggcctgggcgctggtgctg
gcgcgctacagtggcgaccgcgatgtggcctttggcgtgaccgtggccgggcgcccggtg
agcatgccgcagatgcagcgcaccgttggcctgttcatcaacagcgttgccctgcgtgtg
cagttgccggtatcgggtgagcgttgcagtgtgcgccagtggttgcagggcctgctgcaa
agcaacatggagctgcgcgagtacgagtacctgccgctggtggcgatccaggagtgcagc
gagctgcccaagggccagccgctgttcgacagcctgttcgtgttcgagaacgcgccggtg
gaaaccgccgtgctcgaccacgcccagcacctgaacgccagctccgactcgggccgtacc
cacaccaacttcccgttgacggcggtgtgctacccgggtgatgacctgggcctgcacctg
tcgtttgaccagcgttactttgattacccgaccgtcgagcgcctgctggccgagttcaag
cgcctgctgctggcgctggtgcagggctttgatggggaggtgagcgcgctgcctctgatg
ggggcagacgaacagcgcttcctgctggaagactgcaaccgcaccgagcgggcttatccg
ctggagcagagctacatcgcgcagttcgaagcgcaggtggctgcgcaccctgaacgtact
gtggcccgctgcctggaggcctcctatgactacgccgggctgaacctggcggccaaccgc
ctgggccacgccttgatctcggccggcgtaaaggtggaccagccggtggcgctgctggcc
gagcgcgggttgccgctgctgggcatgatcgttggcagcttcaaggcgggcgccggctat
ctgccgctggacccggggctgccggccgcccgcctgcaaagcatcatccagctcagccgt
accccggtgctggtgtgcagcgcggcctgtgccgagcagggccggcagttgctgggtgag
ctggacgttgcagaacggccacagctgctggtgtgggaagacacccaggccagccaggtt
gccagccacaacccgggcatccacagtggcccggacaaccttgcctatgtgatctacacc
tcaggctcgactggcttgccaaaaggggtgatggtcgagcagcgcggcatgctcaacaac
cagttgagcaaggtgccgtatctggcgttgagcaatcaggacgtcattgcccagactgct
tcgcagagcttcgacatttcggtgtggcagttccttgccgcgccgctgttcggcgccaag
gtcgagatcgtgccgaatgccatcgcccatgacccgcagggcctgctggcgcatgtgcag
gccaccggcatcaccgtgctggaaagcgtgccgtcgctgatccagggcatgctggccaac
gaccaccaggccctcgccggcctgcgctggatgctgccgaccggcgaggccatgccacct
gagctggccgcgcagtggttgcagcggtacccgcagatcggcctggtcaacgcctacggc
ccggcagaatgctccgatgatgtggcgttcttccgcgtcgatgccgcatcgacccaaggc
agttacctgccgatcggcacgccgaccgacaacaaccgcctgtacctgttcggcgaagag
caggcgctggtgccgctgggcgcggtgggcgagctgtgcgtggcgggtaccggcgtgggc
cgtggctatgtcggcgatccggtgcgcactgccctggcgttcatcccacacccccatggt
gccgcgggcgagcgcctgtaccgcaccggtgacctggcgcgccagcgcccggacggtgtg
ttggagtacgtcgggcgcatcgaccaccaggtgaagattcgcggctaccgcatcgaactg
ggcgagatcgaagcccgcctgcacgagcaggccgagattcgtgatgctgcggtgggcgtg
caggaaggcgtcaatggcaagcacctggtcggttacctggtggcacaccagggtgtcgcc
gccgatgccacattgctggagcagatcaagcagcgcctgcgtgccgagttgccggagtac
atggtgccgctgcactggggttggttcgacagcctgccgcacaacgccaacggcaagctc
gaccgcaaggcgctgccagccatcgacattggcggtcagcacagccaggcctatcaggcg
ccgcgcaatgagctggaggaagtgttggcctgtatctgggccgatgtgctgaaggccgag
cgagtgggggtgcacgacaacttcttcgagctgggcgggcattcgctgctggccacgcag
atcgcctcgcgggtgcagaagcagctgcagctgaacgtgccgctgcgggcgatgttcgag
tgcagcacggtggaggagctggccgagtatgtgctggggttgcagggcagtgcgctggat
gacgacaaggtcgaccggctcagtgacctgatggccgagctcgaggggctttga

DBGET integrated database retrieval system