KEGG   Pseudomonas putida H8234: L483_23540Help
Entry
L483_23540        CDS       T02706                                 

Definition
(GenBank) peptide synthase
Organism
pput  Pseudomonas putida H8234
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4966761..4979714)
Genome map
AA seq 4317 aa AA seqDB search
MTDAFELPLSLVQALAQRATQTPDKIALRFLADAPGEQAVLSYRDLDQRARTIATALQAR
ASFGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESARQHHQERLLSIIDDAEPRLL
LTVAALHDGLQGLPALSAHNGPELLAVDSLDPALAANWREPVLKGDDIAFLQYTSGSTAL
PKGVQVSHSNLVANEQLIRCGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVL
MSPGYFLARPQRWLQAISEYGGTISGGPDFAYRLCSERVSEASLAGLDLSRWRVAYSGSE
PIRQDSLATFADKFQASGFDPQSFFASYGLAEATLFVSGSRRGQGIDALELDAEAFAANR
AEPGKGSVLMSCGYPQPGHAVRVVEPQHLQVLGDNQVGEIWAAGPSIARGYWRNPEASAR
TFVEMDGQTWLRTGDLGFMRNGEVFVTGRLKDMLIVRGQNLYPQDLEKTLEREVQVLRKG
RVAVFAVEQQGEEGIGVAVEISRNVQKAIEPQALIKTLRQVIADACRQAPAVVLLLNPGA
LPKTSSGKLQRSACRLRMDDGSLDCYARFPDVSETAASAAAGNELQAQIAAVWRDILKVE
AVAADDHFLLLGGNSIAATQATARLADELGINLGLRTLFEAPVLADYSSAVASIMADGAA
GTATIAPLERTQALPQSLAQNRLWLMWQLQPQSAAYNIPAGLQLRGELDESALQAAFQAL
VARHESLRTVFSEENGQPLQRIVAQQPFSLRRLDLEGQTLEQVSAQREAEARQPFDLTQG
PLLRVTLARLDDEDHQLWVTLHHIVADGWSLNILLDEFAKLYAARCQGLEANLAPLGLGY
ADYGTWQRQWLAAGEAERQLQYWKAQLGGDLPVLDLCTDHPRASQREHSAARFNLKVPAT
LAEALKGLAREQQASLFMVLLAGWQALLHRYSGQADIRVGVPNANRPRLEAQGMVGFFIN
TQVLRAQLDGRLPFTQLLAQVRQATLAAQANQDLPFEQLVEALPQAREQGLFQVMFNHQQ
RDLSALRRLPGLLAEELPWHSREAKFDLQLHSEEDHQGRLSLAFDYAAELFEASTVKRLA
HHLLALLEQVCAAPQRALGEVQLLDEPARAQLLGWGRAPATAPPGLLVEQLNEQARLTPQ
RTALAWDGGSLDYAELHQQANRLAHYLRDKGVGPDTCVAIAIERSPQLLVGLLAILKAGG
AYVPLDVDYPAERLAYMLADCNAGLLLSHSSLLGKLPQVDGVSAIALDQLHLDSWPSHAP
GLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQATYALDDSDVLMQKAPISFD
VSVWECFWPLVTGCKLVLAGPGEHRDPQRIAALVQAHGVTTLHFVPPLLQVFVQEPQAGA
CSSLRRVFSGGEALPAALRDRVLQVLPQVQLHNRYGPTETAINVTHWHCQVADGERSPIG
RPLGNVLCRVLDDELELTAPGVSGELYLGGAGLARGYLGRPGLTAERFVPQADGHGERLY
RSGDRARWQVQLQALEYLGRLDQQVKVRGFRVEPEEVQACLLAQPGVEQALVLIHKDAVG
AQLVGYYSGSAQPAELLAVLAEQLPAYMVPAQLIPLAQLPLGPSGKVDRKALPAPVWQQR
EHVEPHTELQQQVAAIWREVLNLPRVGLQDDFFALGGHSLLATQIVSRSRQACDVELPLK
ALFEASELGAFCAEIARIRAAGERNLQGAIARVDRRQAVPLSYSQQRMWFLWQMEPDSPA
YNVGGMARLRGTLHVDAFERALQALIVRHETLRTTFPSIDGIPYQCVAEDSGLHLAWQDL
SALPGDARQQHLQQLADDQAHQPFDLERGPLLRACLVKADEREHFFVLTLHHIVTEGWAM
DIFARELGELYEAFVDDRESPLAPLPVQYLDYSVWQRQWLESGEGARQLAYWKDRLGDEH
PVLALPADRPRPAVQSHRGELYRFELDPALVARVHAFNSQRGLTLFMTMTATLAALLHRY
SGQRDLRIGAPVANRIRPESEGLIGAFLNTQVLRCELDGQMTANALLEQMRQAAIEGQSH
QDLPFDQLVEALQPPRSSAYNPLFQVMCNVQRWAFQQSRTLAGMQVDYLVNDASATKFDL
YLEVTDLDGRLGCCLTYSRDLFDEPRIARMAEHWQHLLVGLLDNPQQRLCELPMLSGAEQ
QVLAGQLQGEHDFDLDQTLHGLFAAQAARTPQAGALTFAGQHMTYAELDQRANRLARALR
ERGVGPQVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLDRLRYMIEDSRIGLLLS
QRELLQTLGELPEGVARWSLEDDAASLSAYRDAPLDNLSLPQHQAYLIYTSGSTGKPKGV
VVSHGEFAMHCQAVIAAFGMRSDDCELHFYSINFDAASERLWVPLLCGARVVLRAQGQWG
AEDICQLVREQQVSILGFTPSYGSQLAQYLGGQDEQLPVRLVITGGEALTGEHLQRIRQA
FAPQQCFNAYGPTETVVMPLACLAPDELPADLGSVPIGRVIGSRTAYILDDDLALLPQGG
IGELYVGGAGLAQGYHDRPGLSAERFVADPFSIEGGRLYRTGDLVRLGTDGLVEYVGRAD
QQVKVRGFRIELGEIESRLQAHADVDEAVVLALDLPGGKQLVGYLVCKQANAGSEAQNLL
REAVKADARQHLPDYMVPAHLVLLDSLPLMGNGKLDRRALPLPDLEQARQHYQAPGNEVE
RQLAQIWRDVLNVAQVGVQDNFFELGGDSILSIQVVSRARQAGLQFTPRDLFQHQTIQTL
AAVVQHSETASTVEQGLRQGQAGLTPIQHWFFDSEVPQPQHWNQAVLLEARQPLDEAVLA
QALALLVQHHDSLRLRFSQAHGRWQAEYAQPDTRPLLWTATVADFADCQALYTDLQRSLD
LQQGPLLRALLVGDGQGSQRLLLAIHHLVVDGVSWRVLLEDLQALYRGQPLPAKTHAMGD
WAARLASYAGSDSLRDELSWWQGQLGGVRRELPCDHPQGGNLHRHAQTLAIGLDVEQTRQ
LLQQAPAAYHTQVNDLLLTALARALSRWSGDEEVLVQLEGHGRDGLFEDMDLTRSVGWFT
NAYPLSLRPLAGEGDVALAGSIKRIKEQLRQVPHKGLGYGVLRYLADTAGREQMAALPQA
RITFNYLGQFDQQFDSAALFQPLEAPTGLAHDLDAPLPNWLSVDGQVYGGALQLRWTFSA
ERYDPQTIARLAEAYRQELLALVAHCLADGNTSFTPSDFPLAHLTQEQIDALPVPAAQIE
DVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSALDPERFAQAWQAVVARHEALRASF
SWNSGEAMLQIIHKPGNLAVDYQDWRGLADEAQEQRLQALHKQEREAGFALLSEAPFHLR
LVRVADERYWFMMSNHHILIDAWCRSLLMNDFFEVYQALGEGRQAQLPVPPRYRDYIGWL
QRQGLEDARAWWQANLAGFERATAIPSDRPLRHDHAGSGMVVGDCYTRLAVSDGVRLREL
AQAHQLTVNTFAQAAWALVLARYSGDRDVAFGVTVAGRPVSMPQMQRTVGLFINSVALRV
QLPASAERCSVRQWLQGLLQSNMEMREYEYLPLVAIQECSDLPKGQPLFDSLFVFENAPV
ETAVLDHAQHLNASSDSGRTHTNFPLTAVCYPGDDLGLHLSFDQRYFDYPTVERLLAEFK
RLLLALVQGFEGEVSELPLLGAEEQRFLLDDCNRTERSYPLEQSYIAQFEAQVAAHPQRT
VARCLEASYDYAGLNLAANRLGHALVAAGVGVDQPVALLAERGLPLLGMIVGSFKAGAGY
LPLDPGLPAARLQSIIQLSRTPVLVCSAACAEQGRQLLGELAVALRPQLLVWEDIQASQI
ASHNPGIHSGPDNLAYVIYTSGSTGLPKGVMVEQRGMLNNQLSKVPYLALSEHDVIAQTA
SQSFDISVWQFLAAPLFGAKVEVVPNAIAHDPQGLLAHVQATGITVLESVPSLIQGMLAN
DHQALDGLRWMLPTGEAMPPELAAQWLQRYPQIGLVNAYGPAECSDDVAFFRVDAASTQG
SYLPIGTPTDNNRLYLFGEEQALVPLGAVGELCVAGTGVGRGYVGDPARTAMAFMPHPYG
LPGERLYRTGDLARQRPDGVLEYVGRIDHQVKIRGYRIELGEIEARLHEQAEIRDAAVGV
QEGVNGKHLVGYLVVHQGIAADGALLEQIKQRLRAGLPEYMVPLHWGWFDSLPHNANGKL
DRKALPAIDIGGQHSQAYQAPRNELEEVLAGIWADVLKAERVGVHDNFFELGGHSLLATQ
IASRVQQQLQLNVPLRAMFECSTVEELAEYVQGLQGSALDDDKVDRLSDLMAELEGL
NT seq 12954 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgccttcgaactcccgctctcgctggtccaggcacttgcgcaacgcgccacg
cagaccccggacaagatcgccctgcgctttctggccgacgcccccggcgagcaggctgtg
ctcagctaccgggacctcgaccagcgtgcacgcaccatcgccactgcgttacaggcccgt
gccagcttcggcgaccgtgcggtgctgttgttccccagtggtccggactacgtggcggcg
ttcttcggttgcctgtatgccggggtgattgcggtaccggcttacccgccagaatccgcg
cgccagcaccatcaggagcgtttgctgtcgatcatcgacgatgccgagccgcgcctgctg
ctgaccgtcgcggcgttgcatgacggcctgcaaggcttgccagcgctgtcggcgcacaac
gggcctgagctgctggcagtggacagcctggacccggcgctggccgcaaactggcgcgag
cccgtgctcaaaggtgatgacatcgccttcctgcaatacacctcgggctccaccgcgctg
cccaagggtgtacaagtcagccacagcaacctggtcgccaacgagcagttgatccgctgt
ggtttcggcatcgacctcaaccccgacgacgtgatcgtcagctggctgccgctgtaccac
gacatggggctgattggcggtctgctgcagccgatcttcagcggcgtgccgtgcgtgctg
atgtcgccgggttacttcctggcccggccgcagcgttggttgcaggccatcagcgaatat
ggcggcaccatcagcggtggccccgactttgcctaccgtctgtgcagcgagcgggtcagc
gaggcctcgctggccgggctcgacctgagccgctggcgcgtggcctattctggctccgag
ccgattcgccaggacagcctggcaaccttcgccgacaagttccaggccagcggcttcgac
ccgcagagcttcttcgccagctacggcctggccgaagccaccctgttcgtcagtggcagc
cgccgtggccagggcatcgacgcgctggaactggacgccgaagccttcgccgccaaccgc
gccgagccgggcaaaggcagcgtgctgatgagctgcggctacccgcagcccggtcacgcg
gtacgtgtcgtggagccgcagcacttgcaggtgctgggcgacaaccaggtcggcgaaatc
tgggcggctggcccgagcatcgcccggggttactggcgcaaccccgaagccagcgcacgc
accttcgttgaaatggacggccagacctggctgcgcaccggcgacctgggcttcatgcgc
aacggtgaagtgttcgtcaccgggcgcctgaaagacatgctgatcgtgcgcgggcagaac
ctgtacccgcaggacctggaaaaaaccctcgaacgtgaagttcaagtgctgcgcaaaggc
cgtgtggccgtgtttgccgtcgagcagcagggcgaggagggcatcggcgtggcggtggag
atcagccgcaacgtgcaaaaggcaatcgaaccccaggcgctgatcaagaccctgcgccag
gtgatcgccgacgcttgccgccaggcgccggccgtggtcctgctgctgaacccgggcgcg
ttgcccaagacctccagtggcaagctgcaacgttcggcctgtcgcctgcgtatggacgat
ggcagcctggactgctacgcccgcttccctgatgtgagcgaaacggctgcaagcgcggct
gccggcaatgagctccaggcacagatcgccgcagtgtggcgggacattctcaaagtagag
gcggttgcggcagacgaccacttcctgctgctgggcggcaactccatcgccgccacccag
gccaccgcacggctggccgatgagctgggtatcaacctgggcctgcgcaccctgttcgaa
gcgccggtactggccgattacagcagcgctgtggcgtcgatcatggccgacggcgctgct
ggcactgccaccattgcaccgctggagcgcacccaggccttgccccagtcgttggcgcaa
aaccgcttgtggctgatgtggcagttgcagccacaatcggctgcctacaacatccccgcc
ggcctgcagctgcgcggcgagctggacgaaagcgccctgcaagccgccttccaggcgctg
gtggcgcgccacgaatccctgcgcaccgtattcagcgaagaaaacggccagcccctgcaa
cgcattgtggcgcaacagccgttcagcctgcgccgcctggacctcgaaggccaaacgctg
gagcaggtcagcgcccagcgggaagccgaggcccgtcagccgttcgacctcactcagggc
cccttgctgcgggtgaccctggcacgcctggacgacgaagatcatcagttatgggtgacc
ctgcaccacatcgtcgcggatggctggtcgctgaatatcctgctggatgaattcgccaaa
ctttacgcagcccgctgtcagggcctggaggccaacctggcgccgctgggcctgggctat
gccgactacggcacctggcagcgtcaatggctggccgccggtgaagccgaacgccaactg
cagtactggaaggcgcagttgggcggtgacctgccggtgctggacctgtgcaccgaccac
ccccgcgccagccagcgcgagcacagtgctgcccggttcaacctcaaggtaccggccacg
cttgccgaagcactcaagggcctggcccgcgaacagcaggccagcctgttcatggtcctg
ctggccggctggcaggcgctgctgcaccgctacagcggccaggccgacatccgtgtcggt
gtgcccaacgccaaccgcccgcgcctggaagcccaaggcatggtcggctttttcatcaat
acccaggtactgcgtgcacagctcgatggtcgcctgccattcacgcagttgctggcccag
gtgcgccaggccacccttgcggcgcaggctaaccaggacttgccgttcgaacagctggtc
gaagccctgccgcaagcccgtgagcaaggcttgttccaggtcatgttcaaccaccagcaa
cgcgacctgtcggccctgcgccgcctgccggggctgctggccgaggagttgccatggcac
agccgcgaagccaagttcgacctgcagttgcacagtgaagaagaccaccagggccgcctg
agcctggccttcgactatgctgcggagctgttcgaagccagcaccgtcaaacgcctggct
catcacctgctggcgctgctggaacaggtgtgcgccgcgccgcagcgggcgctgggcgag
gtgcaattgctggacgagcctgcccgtgcgcaattgctgggctggggccgggcaccggct
accgcgccgccaggcctgctggtcgaacagctcaacgaacaggcccgcctgaccccgcaa
cgcaccgcgctggcctgggacggcggcagcctcgactacgccgaactgcaccagcaggcc
aaccgcctggcccactacctgcgcgacaaaggcgtcggccccgacacctgcgtcgccatc
gccatcgagcgttcgccacagttgctggtcggcctgctggccatcctcaaggccggcggc
gcttacgtgccgctggacgtcgactacccggccgaacgccttgcctacatgctggccgac
tgcaatgccgggctgctgctgagccacagcagcctgctgggcaagctgccgcaggtcgac
ggcgtcagtgccattgccctcgaccagctgcacctggacagctggcccagccacgcgcct
ggcctgcacttgcatggcgacaacctcgcctacgtgatctacacctccggctccaccggc
cagcccaagggcgtgggcaatacccatgcagcgctggccgagcgcctgcagtggatgcag
gcgacctatgcgctggatgacagcgatgtgctgatgcagaaggcgccgatcagcttcgac
gtgtcggtgtgggaatgcttctggccgctggtcaccggctgcaagctggtgctcgccggc
cccggcgaacaccgcgacccgcagcgcatcgccgcgctggtgcaggcccatggcgtgaca
acgctgcacttcgtgccgccgctgttgcaggtgtttgtccaggagccgcaggcgggtgcc
tgcagcagcctgcgccgggtgttctccggtggcgaagcattgcccgccgcactgcgtgac
cgcgtgctgcaggtgctgccgcaggtgcagctgcacaaccgctacggcccgaccgaaacc
gccatcaacgtcacccactggcactgccaggtggcggacggcgagcgctcgccaatcggt
cgcccgctgggcaatgtgctgtgccgcgtgctggacgatgagcttgaactgactgccccc
ggcgtgtcgggcgagctgtacctcggtggcgctggcctggcccgtggctacctgggccgt
ccgggtcttaccgccgagcgcttcgtgccccaggccgacggccacggcgagcgcttgtac
cgcagtggtgaccgcgcgcgctggcaggtgcagctacaggccctggaatacctcggtcgc
ctcgaccagcaggtaaaggtgcgtggtttccgcgtcgagcctgaggaagtacaggcctgc
ctgttggcacagccgggtgtggaacaggcgctggtgctgatccataaggacgccgttggt
gcgcaactggtgggttactacagtggcagtgcgcagccagccgaactcctggccgtgctg
gctgagcaactgcccgcgtacatggtgccggcgcagctcatcccgttggcacagctgccg
ctgggccccagcggcaaggtcgaccgcaaggcgctgccggccccggtgtggcagcaacgc
gaacatgtcgagccccacaccgagttgcaacaacaggtcgccgccatctggcgtgaggtg
ctgaacctgccgcgcgtcggcctgcaggacgacttcttcgccctgggcgggcactcgctg
ctggccacccagatcgtctcgcgcagccgccaggcctgtgatgtcgagctgccgctcaag
gccctgttcgaagccagtgaactgggcgccttctgtgccgaaatcgcacgcatccgcgcc
gccggcgagcgcaacctgcaaggcgcaatcgcccgggtcgaccgccgtcaggcggtgccg
ctgtcgtactcgcagcagcgtatgtggttcctctggcaaatggagccggacagcccggcg
tacaacgtcggcggcatggcacgcctgcgcggcaccctgcacgtggacgccttcgagcgt
gcgttgcaggcgctgatcgtgcgtcacgaaaccctgcgtacaaccttccccagcatcgac
ggcatcccgtatcagtgcgtggccgaagacagcggcctgcacctcgcctggcaagacctg
agcgccttgcccggcgatgcccgccagcaacacctgcaacaacttgccgacgaccaggcg
caccagccgttcgacctggagcgcggcccgctgctgcgcgcctgcctggtcaaggctgac
gagcgcgagcatttcttcgtgctcaccctgcaccacatcgtcaccgaaggctgggccatg
gacattttcgcccgcgagctaggcgaactgtacgaagcctttgtcgatgaccgcgagtcg
ccgctggcgccgctgccggtgcaatacctggactacagcgtatggcaacggcaatggctg
gaaagcggcgagggcgctcgtcaactggcctactggaaggaccgcctgggtgacgagcac
ccggtgctggcgttgcctgccgaccgcccgcgtccggcagtacagagccaccgcggcgag
ctgtaccgctttgaactcgacccggcgctggtcgcccgcgtgcacgccttcaacagccag
cgcggcctgaccctgttcatgaccatgaccgccaccctggctgccttgctgcaccgttat
agcggccagcgtgacctgcgcatcggcgcgccggtggcgaaccgcatccgcccggaaagc
gaaggcctgatcggcgccttcctcaatacccaggtgctacgttgcgagctggacggccag
atgaccgccaacgcgctgctggagcagatgcgccaggccgccatcgaagggcagtcgcac
caggacctgccgttcgatcagttggtcgaagcgttgcaaccgccgcgcagcagcgcgtat
aacccgctgttccaggtgatgtgcaacgtgcagcgctgggccttccagcaaagccgcacg
ttggccggcatgcaggtggattacctggtcaacgatgccagtgccaccaagttcgacctg
tacctggaggtcaccgacctcgacggccgcctgggttgctgcctgacttacagccgcgac
ctgttcgacgaaccgcgcatagcgcgcatggccgagcactggcagcacctgctggtcggc
ttgctggacaacccgcagcagcgcctgtgcgagctgccgatgctgagcggtgcggagcag
caggtgctggcgggtcagttgcagggcgagcacgacttcgacctcgaccagaccctgcac
ggcctgttcgccgcccaggcggcgcgcacaccacaggctggcgcgctgaccttcgctggc
cagcacatgacttacgctgaactcgatcagcgggccaaccgcctggcccgcgccctgcgc
gagcgtggcgtcggcccgcaggtgcgcgtgggcctggcgctggagcgctcgctggaaatg
gtcgtcggcctgctggccatcctcaaggccggcggcgcctacgtgccgctcgaccccgag
tacccgctcgaccgcttgcgctacatgatcgaagacagccgcatcggcctgctgctcagc
cagcgtgagctgttgcaaaccctgggcgagctgcctgagggcgtggcccgctggagcctg
gaggacgatgccgccagcctgtcggcctacagggatgcgccgctggacaacctcagcctg
ccgcagcatcaggcgtacctgatctacacctccggctccaccggcaagcccaagggcgtg
gtggtcagccatggcgaatttgccatgcactgccaagcggtcatcgccgcgttcggcatg
cgcagcgatgattgcgagctgcatttctattcgatcaacttcgacgctgccagcgagcgc
ctgtgggtgccgttgctgtgcggtgcccgcgtggtgctgcgcgcccaggggcagtggggc
gccgaggacatctgccagctggtgcgcgagcagcaggtgagcattttgggctttaccccc
agctacggtagccagctggcgcaatacctgggcgggcaggacgagcaactgccggtgcgc
ctggtgatcaccggcggcgaagcgctgaccggcgagcacctgcagcgtattcgccaggcc
tttgcgccacagcagtgcttcaacgcctacggcccgaccgaaaccgtggtcatgccgctg
gcctgcctggcgccagacgagttgccagcggaccttggcagtgtaccgatcggccgcgtc
atcggtagccgcacggcctatatcctcgacgacgaccttgccctgttgccgcaaggcggc
attggcgaactgtacgttggcggcgccggcctggctcaggggtatcacgaccgcccgggc
ctcagcgccgagcgcttcgtcgccgacccgttcagcatcgaaggtggccgcttgtatcgc
actggcgacctggtgcgcctgggcactgacggcctggtcgagtacgtcggccgtgccgac
cagcaggtgaaggttcgcggcttccgtattgaactgggtgaaatcgagagccgcttgcag
gcgcacgccgatgtcgacgaggccgtggtgctggccctcgacctgccgggcggcaagcag
ttggtgggttacctggtgtgcaagcaggccaacgcgggtagcgaggcgcaaaacctgctg
cgtgaagcggtgaaagccgatgcccgccagcacctgccggactacatggtgcctgcgcac
ctggtactgctcgacagcctgccgctgatgggtaacggcaagctcgaccgccgtgcgctg
ccgctgccggacctggaacaagcgcgtcagcactaccaggcacctggcaacgaggtggaa
aggcagttggcgcagatctggcgcgatgtgctcaacgttgcccaggtcggtgtacaggac
aacttcttcgaactgggcggcgattcgatcctgtccatccaggtggtcagccgggcccgt
caggccgggttgcaattcaccccgcgcgacctgttccagcaccagaccatccagaccctg
gcggctgtcgttcagcacagcgaaaccgcgagcacggtggaacaggggctgcgccagggc
caggccgggctgacaccgattcagcattggttcttcgacagtgaagtaccccagccacag
cactggaaccaggccgtgttgctggaggcgcgccaaccgctggatgaggcggtactggcg
caggccttggcgctgctggtgcagcaccacgacagcctgcgcctgcgcttcagccaggcc
catggccgctggcaggccgaatacgcccagcctgataccaggccattgctatggaccgcc
accgttgccgatttcgctgattgtcaggcgctgtacaccgacctgcagcgcagcctcgac
ctgcaacagggcccactgctgcgcgccttgctggtgggtgacgggcagggcagccagcgc
ctgttgctggcgatccatcacctggtggtcgatggcgtgtcctggcgggtgctgctggag
gacctgcaggcgctgtaccgcggccagccactgccggccaagacccatgccatgggcgat
tgggctgcgcgtctggccagctacgccggcagcgattcgttgcgtgacgagctgagctgg
tggcaaggccagctgggcggcgtgcgtcgcgagctaccgtgtgatcacccgcagggcggc
aacctgcaccgccatgcgcagaccctggccatcggcctggacgtggagcagacccggcaa
ctgctgcaacaggccccggcggcttaccacacccaggtcaacgacctgctgctgactgca
ctggcgcgtgcgttgagccggtggagcggcgatgaagaagtgctggtacagcttgaaggc
catggccgtgacgggttgttcgaagacatggacctgacccgcagcgttggctggttcacc
aacgcctatcccctcagcttgcgcccgctggcaggcgaaggcgacgtggcgctggccggc
tcgatcaagcgtatcaaggagcaactgcgccaggtgccgcacaaggggctgggctatggc
gtactgcgctacctggccgacacggccgggcgcgagcagatggcggccttgccgcaggcg
cgtatcaccttcaactacctgggccagttcgaccagcagttcgacagcgcggcgctgttc
cagcccctggaagcaccgaccggcctggcgcatgacctcgatgcaccactgcctaactgg
ctgagcgtcgatggccaggtatatgggggggccttgcagctgcgctggaccttcagcgcc
gagcgctatgacccgcaaaccatcgcccgcctggccgaggcctatcgccaggaactgctg
gcgctggtcgcgcattgcctggccgatggcaacaccagcttcaccccgtcggacttcccg
ctggcgcatctcactcaggagcagatcgacgcgttgccggtacccgctgcgcagatcgag
gacgtctacccactgacgccgatgcaggaaggcatgctgctgcacaccctgctggagcca
ggcaccggcctctactacatgcaggaccgctaccgcatcaacagcgcgctggaccctgaa
cgttttgcccaggcctggcaggccgtggtggcacgtcacgaagcgttgcgggcatcgttc
agctggaacagcggcgaggcgatgctgcagatcatccacaaaccgggcaacctggcggtg
gactaccaggactggcgcggccttgctgacgaggcccaggagcagcgcctgcaggccctg
cacaagcaggagcgcgaggccggttttgccctgctcagcgaagcaccgttccacttgcgc
ctggtgcgtgtggccgacgagcgctactggttcatgatgagcaaccaccacatccttatc
gatgcctggtgccgctcgctgctgatgaacgacttctttgaggtttaccaggccctcggc
gaaggccgccaggcccagttgccggtgccgccgcgttaccgcgattacatcggctggttg
cagcgtcagggcctggaggatgcgcgcgcctggtggcaggccaacctggccggcttcgaa
cgcgccaccgccatccccagcgaccgcccgctgcggcatgaccacgctggcagcggcatg
gtcgtcggcgactgctacacccgcctggcggtgagtgacggcgtgcgcctgcgcgaactg
gcccaggcccaccagcttaccgtcaacaccttcgcccaggcggcctgggccttggtgctg
gcacgctacagcggcgaccgcgacgtcgcctttggcgtgaccgtggccgggcgcccggtc
agcatgccgcagatgcagcgcaccgtcggcctgttcatcaacagcgttgccttgcgtgtg
cagttgcccgcatccgctgagcgttgcagtgtgcgccagtggctgcagggcctgctgcaa
agcaacatggaaatgcgcgagtacgaatacctgccgctggtggcgatccaggagtgcagc
gacctgcccaagggccagccgctgttcgacagcctgttcgtgttcgagaacgcgccggtg
gaaaccgccgtgctcgaccacgcccagcacctgaacgccagctccgactcgggccgtacc
cataccaacttcccgttgacggcggtgtgctacccgggcgacgacttgggcctgcacctg
tcgttcgaccaacggtacttcgactacccgaccgtcgagcgcctgctggccgagttcaag
cgcctgctactggcgctggtacaaggctttgaaggggaggtgagcgagctaccgttgttg
ggtgccgaggagcagcgtttcctgctggacgactgcaaccggaccgagcggtcctatccg
ctggagcagagctacatcgcacagttcgaagcacaagtggccgcacatccgcagcgcact
gtggcccgctgcctggaggcgtcctatgactacgccgggctgaacctggcagccaaccgc
ctgggccatgccctggtggctgccggggtcggcgtggatcagccggtggcgctgctggcc
gagcgcgggttgccgctgctgggcatgatcgttggcagcttcaaggccggcgcgggctac
ctgccgctggacccgggcctgccggcggcgcgcctgcaaagcatcatccagctcagccgt
acgccagtgctggtgtgcagcgccgcttgtgccgagcaggggcggcagttgctgggcgag
ctggcggttgcactgcggccgcaattgctggtctgggaagacatccaggccagccagatc
gcaagccacaacccgggcatccacagtggcccggacaacctcgcctatgtgatctacacc
tcagggtcgaccggcctgccgaaaggggtgatggtcgagcagcgcggcatgctcaacaac
caactgagcaaggtgccgtacctggccctgagcgagcatgacgtgatcgcccagaccgca
tcgcaaagcttcgatatttcggtgtggcagtttcttgccgcgccgctgttcggcgccaag
gtcgaggtcgtgccgaacgccatcgcccatgatccgcagggcctgctggcgcatgtgcag
gccaccggcatcaccgtgctggaaagcgtgccgtcgctgatccagggtatgctggccaac
gaccatcaggccctcgacggcctgcgctggatgctgccgaccggcgaggccatgccaccg
gaactggcggcgcagtggctgcagcgttacccgcagatcggcctggtcaacgcctacggg
ccggcagagtgctcggatgacgtggcgttcttccgcgtcgatgccgcgtcgacccaaggc
agctacttgccgatcggcactccgaccgacaacaaccgcctgtacctgttcggcgaagag
caggcactggtgccgctgggcgcggtgggcgagctgtgcgtggctggcacgggtgttggt
cgtggctatgtcggtgacccggcgcgcacggcaatggcgttcatgcctcacccttacggg
ctacctggagagcggctgtaccggaccggtgacctcgcacggcagcgcccggacggtgtg
ctggagtacgtcgggcgcatcgaccaccaggtcaagatccgtggttaccgcatcgagctt
ggcgagatcgaagcccgcctgcacgaacaggccgagattcgcgatgctgcagtgggcgtg
caggaaggcgtcaacggcaaacatctggtcggttacctggtggtacaccagggtatcgcc
gccgatggcgcattgctggagcagatcaagcagcgcctgcgggctgggttgccagagtac
atggtgccgctgcactggggttggttcgacagcctgccgcacaacgccaacggcaaactc
gaccgcaaggccctgccggccatcgacatcggcggccagcacagccaggcctatcaggcg
ccgcgcaacgagctggaggaagtgctggcgggcatttgggccgatgtgctcaaggccgag
cgggtgggggtacacgacaacttcttcgagctgggcgggcattcgctgctggccacgcag
atcgcttcgcgggtgcagcagcaattgcagttgaacgtgccattgagggcgatgttcgag
tgcagcacggtggaggagctggccgagtatgtgcaggggttgcagggcagtgcgctggat
gacgacaaggttgaccggcttagtgacctgatggccgagcttgaggggctttga

DBGET integrated database retrieval system