KEGG   Pseudomonas sp. UW4: PputUW4_01483Help
Entry
PputUW4_01483     CDS       T02357                                 

Gene name
pvdL
Definition
(GenBank) Non-ribosomal peptide synthase
Organism
ppuu  Pseudomonas sp. UW4
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1717918..1730916
Genome map
AA seq 4332 aa AA seqDB search
MTDAFELPSTMVQALQRRAALTPDRVALRFLAETPEQAVVLSYRELDQRARTIAGALQAQ
VDVGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESTRRHHQERLLSIISDAQPRLL
LTSAGLRDALQQIEGAPPLLCVDTLDGALAERWVAADLQDDHIAFLQYTSGSTALPKGVQ
VSHCNLVANELLIRHGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVLMSPAY
FLGRPLRWLEAISEYGGTISGGPDFAYRLCSERVSESALERLDLSGWRVAYSGSEPIRLD
TLERFAEKFATCGFTADSFMASYGLAEATLFVAGTARGEGIGNLRVDDQALAQNRVEVGE
GSPIMSCGISQPAHAVLIVDPVSLSEQADNAVGEVWASGPSIALGYWRNPEASAKTFVRH
AGQTWLRTGDLGFMRNGELFITGRLKDMLIVRGHNLYPQDIEQTVEREVEVVRKGRVAAF
AVTVDGQEGIGIAAEISRSVQKILPPEALIKAIRQAVAEAYQEAPSVVVLLNPGALPKTS
SGKLQRSACRSRLADGSLDSYALFPSASTENASQVESGSELQSLIGRIWCEQLQVGQVGA
DDHFFLLGGNSIAATQVVARLREALGLELNLRLLFEAPTLGAFADAVARQQQDGGLAQGA
ITALSRQQPMPQSLAQNRLWITWQLDPHSSAYNIPGALRLRGELDENALRASFQQLIERH
ESLRTRFFERDGVALQQVTAGAEFNLQMIDISDLPAAEREARALQIREDEARTRFDLEKG
PLLWVTLVRLDDEDHQLLVTMHHIIADGWSLNVLIDEFSRLYAAASQGQQALLAPLPTQY
ADYASWQRQWLAQGEGERQLAYWKARLGDEHPTLSLATDHPRCAQQLHSAARHTLRLGAA
LSDAIRQTAQAHESTSFMLLLAAFQALLHRYSGQRDIRIGVPNANRPRLETQGLIGFFIN
TQVLRAEVDSRLPFTELLGQTRQAALGAQAHQDLPFEQLLEAFPQAREQGLFQVMFNHQQ
RDLSALKRLPGLLAEELPWHSRQAKFDLQLHSEEDRNGRLSLSFDYASELFDAATIERLS
GHYANLLREVCERPQTALGDLQLLTEPEHNQQANWSVAPCTQASQWLPERLDEQARRTPQ
RTALLWDGGQLDFAGLHTQANRLAHYLRDKGVGPDVCVAIACERSPQLLIGLLAIIKAGG
AYVPLDPDYPAERLSYMLSDSGVELLLTQTCLLDRLPASQGVSVIAMDTLHLDSWPSQAP
GLHLQGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQQTYQLNETDVLMQKAPISFD
VSVWECFWPLITGSRLLLAGPGEHRDPQRIAQLVQAYGVTTLHFVPPLLSLFIDEPLSVQ
CTSLRRVFSGGEALPAELRNRVLAQLPAVQLHNRYGPTETAINVTHWQCSSADGERSPIG
RPLGNVICRVLDSELNPVPAGVPGELCISGSGLARGYLGRPGLTAERFVVDPLGEHGARL
YRTGDRARWAGDGVIEYLGRLDQQVKLRGFRVEPQEIEARLLAQEGVAQAVVLVRETAAG
GQLVGYFTTTDTAESVDAQTTRLKAALTAQLPEYMVPAQLMRLDQMPLGPSGKLDRRALP
EPQWQVREHVEPVTELEQQIAGIWREVLGLTPVGLRDDFFALGGHSLLATQIISRTRQAC
DVELPLRTLFEHSELGAFAEQVRLIQASGSTNKQPPIETVDRRQAVPLSYSQQRMWFLWQ
MEPDSPAYNVGGMARLRGVLDVARFEAALQALIMRHETLRTTFPSVDGVARQQVHMETGV
RMAWKDFSALDAEGREWQVQQLADDEAHLPFDLETGPLLRACLVRTGEQEHYFVLTLHHI
VTEGWAMDIFARELSALYEAFVDDRESPLAPLPVQYLDYSMWQRQWLESGERQRQLDYWT
TQLGHEHPLLELPADRPRPPVQSHQGELYRFDLSDELAARVRAFNAQHGLTLFMTMTAAL
ATLLYRYSGQTDLRIGAPVANRIRPESEGLIGAFLNTQVLRCQLDGQMSVGELFEQVRHT
VIEGQSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQSRTLAGMTVEYLANDA
RATKFDLNLEVTDLDHRLGCCLTYSTDLFDEPRIARMAGHWRNLLEALIADSQQRLSELP
LLASGEQQLLLDSLGVEAGEHRLDQCIHHLFAEQALVRQDAPALTFAGQTLSYAELDSRA
NRLAWMLRERGVGPQVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLDRLHYMIED
SGIGLLLSDAAMFKALGELPATVGRWCLEEDAAALAHFPATELPPISLAQHHAYLIYTSG
STGKPKGVVVSHGEIAMHCRAVIERFGMRPDDCELHFYSINFDAATERLLVPLLSGAHVV
LRAQGQWDAEEICGLIRRHQINVLGFTPSYGSQLAQWLATQDQTLPVRMIITGGEALTGE
HLARIRAAFKPSRFFNAYGPTETVVMPLASLAPEVLEEGAGSVPIGSVIGDRVAYILDAD
LALVPQGATGELYVGGAGLAQGYHQRPGMTAERFVADPFAADGGRIYRTGDLVRQGADGL
VEYLGRIDHQVKIRGFRIELGEIETRLLDHDSVREAVVLALDAPSGKQLVGYLVTDVAEQ
DEAQQSMLREALKAHLKSQLPDYMVPTHLILLASMPLTGNGKLDRRALPAPDPELNRQDY
VAPSNELEVTLAQIWCDVLNVEQVGLNDNFFELGGDSILSIQVVSRARQQGIHFTPRDLF
QHQTVQTLAAVATRSEQISAEQGLILGESRLTPIQHWFFDTDIAQRQHWNQALLLQPTVV
LESHRLEQALLAVIEQHDALRLRFGKDAGQWQALHQPISDAPVLWQVRVSSMDKCAALFA
DAQRSLDLEQGPLLRVLLVDGPEGQQRLFIAIHHLVVDGVSWRVLLDDLQTLYRQLEARQ
SVKLPAKTSAFKDWAARLQAYAGSESLREELGWWQAQLAGPSADLPCDHPEGGRQNRHAQ
TVSVRLDSERTRQLLQQAPSAYRTQVNDLLLTALARVLCRWSGQPSALIQLEGHGREALF
DDIDLTRTVGWFTSAYPLRLTPSNIEEVAGQGASIKAIKEQLRAVPHKGLGYGVLRYLAD
EPIRRSMATLPQAPITFNYLGQFDQSFGADALFHPLDEAVGAAHDAHAPLPNELSVDSQV
YGGELVLRWTFSAERFDPSTIGELADAYLGELSSLIEHCLRDDAGGLTPSDFPLAQLNQT
QLDALPVPAAVIEDVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSELDPQRFAQAWQ
AVVARHEALRASFCWNVGEDMLQVIHKPGSTPIEYLDWRDIAQAEQEPKLQALLKTEREA
GFDLLNQAPFHLRLIRVDAARYWFMMSNHHILIDAWCRSLLMNDFFEIYSALGEGREAQL
GPVSRYRDYIGWLQRQSLDEARQWWKTSLQGFERTTPIPSDRPFLREHAGDSGGMIVGDR
YTRLDARDGAQLRELAQAHQLTINTFAQAAWALVLRRLSGDRDVLFGVTVAGRPVEMPQM
QRTVGLFINSIALRVKMPEDGQRCSVRQWLSGLLDSNMQLREYEYLPLVNIQEQSELPKG
QPLFDSLFVFENAPVEVSVLDRAQSLNATSDSGRTHTNFPLTAVCYPGDDLGLHLSYDQR
YFDEATVERMLGEFKRLLLALVEGFHGDMADLPLLGAEEQDFLLHGCNQSEHEYPLQQSY
VSLFETQVARHPQRIAASCLDRQYSYLELNQRSNRLGHALIAAGVGRDQPVALLAERSLD
LLGMIIGSFKAGAGYLPLDPGLPSQRLSRIIELSRTPLLVCTQACREQAQALLDEFGCAS
RPRLLVWEEVQALALSADNPGIYSSADNLAYVIYTSGSTGLPKGVMVEQRGMLNNQLSKV
PYLDLSDADVIAQTASQSFDISVWQFLAAPLFGARVDIVPNTIAHDPQGLLAHVAAQGIT
VLESVPSLIQGMLAQERMSLDGLRWMLPTGEAMPPELAHQWLLRYPQIGLVNAYGPAECS
DDVAFFRVDLASTRGSYLPIGTPTDNNLLYVLDGALELVPLGAVGELCVAGTGVGRGYVS
DPLRTAPVFVPNPFGAPGERLYRTGDLARRRSDGVLEYVGRIDHQVKIRGYRIELGEIEA
RLHEQPEVRDAAVGVQEGANGKHLVGYLVAAQVASSPAEGLERIKQRLRAELPEYMVPLH
WLWLDKLPLNANGKLDRKALPALEIGQMQSQDYQAPRNDLEQTLADIWAEVLKVEKVGVR
DNFFELGGHSLLATQIASRVQKSLQRDVPLRAMFECSTVQELAGYIDGLAASEITEEKVD
RLNDLMAELEGL
NT seq 12999 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcgttcgaactccccagcacaatggtccaagcccttcagcgccgcgcggcc
ctgacgccggatcgggtggccctgcgttttcttgccgagaccccggaacaggctgtggtg
ctcagttatcgcgagctggatcagcgggcgcgaacgattgccggcgccttgcaggctcaa
gtggatgttggcgaccgcgccgtgttgttgttccccagcggcccggattacgtcgcggcg
tttttcggttgcctgtacgccggggtgatcgcggtcccggcctacccgccggaatcgacg
cgccgtcatcaccaggagcgcctgctgtcgatcatcagcgatgctcaaccgcgcctgctg
ctgaccagcgccgggctgcgcgatgcattgcagcaaatcgaaggggcgccgccgttgctg
tgtgtcgacaccctcgacggtgcactggccgaacgctgggtcgcggcggatttgcaggac
gatcacatcgccttcctgcaatacacctccggctccaccgcactgcccaagggcgtgcaa
gtcagccactgcaatctggtggccaacgaattgctgattcgtcacggcttcggcatcgac
ctcaaccccgacgacgtgatcgtcagctggctgccgctgtaccacgacatgggcctgatc
ggcggcttgctgcagccgattttcagcggcgtgccttgcgtgttgatgtcaccggcgtac
ttcctcggccggccgttgcgctggctggaagcgatcagcgaatacggcggcaccatcagc
ggcgggccggattttgcctatcgcctgtgcagcgagcgggtcagtgaatcggctctggaa
cggctggacctgagtggctggcgcgtggcgtattccggttccgaaccgattcgcctcgac
accctggaacgcttcgccgagaagttcgcgacctgcggtttcactgcggacagcttcatg
gcctcttacggtctggccgaagccaccttgtttgtggccggcacagcacgcggcgaaggc
atcggcaacctgcgggtggacgatcaggctctggcgcagaaccgggtggaagtgggcgag
ggcagcccgatcatgagttgtggcatcagccagccggctcacgccgtgctgatcgtcgac
ccggtctcgctcagcgaacaggccgacaacgccgtcggcgaagtctgggccagcgggccg
agcatcgccctcggttattggcgcaaccccgaggcgtcagccaaaacgttcgtccggcac
gccggccagacctggttgcgaaccggtgacctgggtttcatgcgcaacggcgagctgttc
atcaccggccgtctgaaggacatgctgatcgtgcgcgggcacaacctgtacccgcaggac
atcgaacagaccgtcgagcgcgaagtggaagtggtgcgcaagggccgtgttgccgccttt
gccgtcacggtcgatggtcaggagggcatcggcatcgccgccgaaatcagccgcagcgtg
cagaaaatcctgccgcccgaggccctgatcaaagccattcgccaggccgtcgccgaggcg
tatcaggaagcaccgagcgtggtggtgctgctcaatccgggtgcgctgcccaagacgtcc
agcggcaaattgcaacgctcggcgtgccgcagtcgactggcggacggcagcctcgacagc
tacgcgctgttcccgtcggccagcaccgaaaatgcaagccaggtcgagtcgggctctgag
ctgcaaagcctgatcggccgtatctggtgcgagcaattgcaggtcgggcaggtgggcgcc
gacgatcatttcttcctgctcggcggcaactccattgcagcgacgcaagtggtggcgcgt
ctgcgtgaagcgctggggctggagttgaacctgcgcctgctgttcgaagccccgaccctc
ggcgccttcgccgatgccgtggcccgtcagcaacaggacggtggcctggcccagggcgcg
atcacggcgctgtcgcgccagcaaccgatgccgcaatcgctggcacaaaaccgtttgtgg
atcacctggcaactcgacccccacagcagcgcctacaacattccgggtgccttgcgcctg
cgtggcgagctggacgagaacgcattgcgcgccagtttccagcagttgatcgagcgccac
gaatccctgcgcacgcggttcttcgagcgtgatggcgtggctctgcagcaggtcactgcg
ggtgctgagttcaacctgcaaatgatcgacatcagcgacttgccggccgccgaacgtgaa
gcccgcgcgctgcagatccgcgaggatgaagcgcggacccggttcgacctagagaaaggc
ccgctgttgtgggtgacgctggtgcgcctcgacgacgaagaccatcagttgttggtgacg
atgcatcacatcatcgcggacggctggtcgctgaatgtgctgatcgacgagttctcgcgc
ctgtatgcggcggcctcccaaggccagcaagcgctcctggcgccattgccgacgcagtac
gccgattacgccagctggcagcgccaatggctggcgcaaggggagggcgagcggcaactg
gcctactggaaagcccgtttgggcgatgagcatccgaccctgagcctggccaccgatcat
ccgcgctgcgcacaacaactgcacagcgccgcccgccataccctgcgtctgggtgcggcc
ctcagtgatgcgattcgccagaccgcccaggcccacgaatcgacctccttcatgctgctg
ctcgccgcgttccaggccttgttgcatcgctacagcggtcagcgtgacatccgcatcggc
gtaccgaacgccaaccgtccgcgcctggaaacccagggcctgatcggctttttcatcaac
acccaggtgctgcgcgccgaggtggattcacggctgccgttcactgagctgcttgggcaa
acccgtcaggcagcgctgggtgcgcaagcgcatcaggacttgccgttcgagcagttgctt
gaagcttttccgcaggcccgtgaacagggtttgttccaggtcatgttcaaccaccagcag
cgcgacctcagtgccttgaaacgcctgccggggttgctggccgaagagctgccgtggcac
agccggcaagccaagttcgacctgcaattgcacagtgaagaagatcgcaacgggcgcttg
agtctgtccttcgactatgccagcgagttgttcgatgcggcgaccatcgagcgcctgtcc
gggcattacgccaacctgttgcgtgaagtctgcgagcgtccgcaaacggccctcggcgat
ctgcaactgctcactgaacctgagcacaaccagcaagcaaactggtccgttgcaccctgc
acacaggccagtcaatggctgccggaacggcttgacgaacaagcccggcggaccccgcag
cgcacggcgttgctgtgggacggcggtcagttggacttcgccggactgcatacccaggcc
aaccgcctggcccattacctgcgcgacaagggcgtcggcccggacgtctgcgtggccatt
gcctgcgagcgttcgccgcaactgctgattggcctgctggcgatcatcaaggccggtggt
gcttatgtaccgctggatccggactacccggccgagcgcctgtcctacatgctcagcgac
agcggtgtcgaactgctgctgacgcaaacctgcttgctcgatcgcttgccggccagccag
ggcgtcagtgtgatcgccatggataccttgcacctggacagctggccaagccaggcgccg
ggcctgcatctgcagggcgacaacctcgcctatgtgatttacacctcgggatcgaccggt
caaccaaaaggcgtcggcaacacccacgcggcgctggccgagcgcctgcaatggatgcag
caaacctatcagttgaacgaaaccgacgtgctgatgcaaaaggcgccgatcagtttcgac
gtgtcggtgtgggagtgcttctggccgctgatcaccggcagtcgcctgttgcttgccggc
cccggcgaacaccgtgatccccagcgcatcgcgcagcttgtgcaagcgtacggcgtgacc
acgctgcacttcgtaccgccgctgctttcgttgttcatcgacgaaccgctcagcgtgcaa
tgtacgagcctgcgccgcgtattctccggtggcgaagccttgccagcggagttgcgcaac
cgcgtgctggcgcaactgccggccgtacagttgcacaaccgctacggtccgaccgaaacc
gcaatcaacgtcacccattggcagtgttccagcgccgatggcgaacgttcgccgattggc
cggccactgggcaatgtgatctgccgcgtgctcgacagcgagctcaatccggttccggcc
ggtgtaccgggtgagttgtgcatcagtggcagcggcctggcgcgtggctatctgggccgt
ccgggcctgacggcggaacgctttgtcgtcgatccattgggcgagcacggcgcgcgtctg
taccgcaccggtgatcgtgcacgctgggctggcgatggcgtgatcgagtatctcggtcgc
ctcgatcagcaggtcaagctgcgcggtttccgcgtcgagccacaggaaatcgaagcccgt
ctgctggcgcaggagggtgtcgcccaagcggtggtgctggtgcgcgaaacggcggcgggt
ggacaactggtcggttacttcaccaccaccgacactgctgagtccgtcgatgcgcaaacg
actcgcctgaaagcggcgctgacggcgcagctgccggaatacatggtcccggctcagctg
atgcggctggaccaaatgcccctcggcccgagcggcaaactcgaccgtcgcgccttgccg
gaaccgcagtggcaggttcgcgaacacgtcgagcccgtgaccgaactggagcaacagatc
gccggcatctggcgcgaagtgctgggcctgacgcccgtcggcctgcgcgatgatttcttt
gccctcggcggccactcgctgctggccacgcaaatcatctcccgcacccgccaggcctgt
gacgtcgagttgccgctgcggacgctgttcgaacacagcgaactgggtgcatttgccgaa
caggtccgcttgatccaggccagcggcagcaccaacaaacagccgccgattgaaacagtc
gaccgtcgtcaggcggtgccgctgtcctattcccagcagcgcatgtggttcctctggcag
atggaaccggacagcccggcctacaacgtcggcggcatggcgcggctgcgcggcgtgctg
gatgtcgcgcgtttcgaagcggcgctgcaagccttgatcatgcgccatgaaaccctgcgc
acgacgttcccgagcgttgacggcgtcgctcgccaacaggtgcacatggagaccggcgtg
cgcatggcgtggaaggatttctccgcgctggatgccgagggccgcgagtggcaggtccag
caactggccgacgacgaagcgcacctgccgttcgatctggagaccggaccgctgttgcgt
gcatgcctggtcaggaccggcgagcaggaacactacttcgttctgaccttgcaccacatc
gtcaccgaaggctgggcgatggacatctttgcccgggaactcagtgcgctgtacgaagca
tttgtcgacgaccgtgagtcgccgctcgcgccgttgccggtgcagtacctggattacagc
atgtggcagcgtcagtggctggagtcgggcgaacgtcagcgtcagctcgattactggacc
acgcaactgggccatgagcatccgctgctggagttgccggctgaccgtccgcgtccgccg
gtacaaagccatcagggtgagctgtatcgctttgacctgagcgacgagctcgcggcacgg
gtccgtgccttcaatgcacagcacggcctgaccctgttcatgaccatgaccgccgcactg
gcgaccctgctgtaccgctatagcggccagaccgatctgcgcatcggcgcgcctgtggcc
aaccgcattcgtccggaaagcgaggggctgatcggcgcattcctcaacacccaggtgctg
cgctgccagctcgacggacagatgtctgtcggcgagctgttcgagcaggtgcgccacacg
gtaatcgaaggccagtcccatcaggacctgccgttcgatcatctggtggaggccttgcaa
ccgccgcgcagtgcagcctacaacccgttgttccaggtgatgtgcaacgtgcagcgctgg
gagttccagcaaagccgcaccctggccggcatgacggtcgagtacctggccaacgatgcc
cgcgcgaccaagttcgacctcaacctggaagtcaccgacctcgatcatcgactgggctgc
tgcctgacctacagcaccgatctgttcgacgaaccgcgcatcgcccgcatggccgggcat
tggcgcaacctgctggaggcgctgattgccgattcgcaacaacgcttgagcgaactgccg
ctgctggcgtccggcgagcaacagctactgctcgacagcctcggtgtcgaggcgggcgaa
catcggctggatcagtgcatccatcacctgttcgccgagcaagccctggtgcgccaggac
gcgccggccctgaccttcgccgggcagaccctgagctacgccgaactcgatagccgcgcc
aaccgcctggcctggatgctgcgcgagcgtggtgtcggcccccaggttcgtgtggggctg
gcacttgagcgctcgctggaaatggtggtcggcctgttggcgatcctcaaggcaggcggt
gcctatgtgccgctggatccggaatacccgctggaccgcttgcactacatgatcgaagac
agcggcatcggtttgctgctcagcgatgcggcgatgttcaaggccctgggcgagttgccg
gcgaccgtcggccgctggtgtcttgaagaagacgccgctgcgctggcccatttcccggcc
accgagctgccgccgatcagtctggcgcagcatcacgcctacctgatctacacctcgggc
tcgaccggcaaaccgaaaggcgtggtggtgtcccacggtgaaatcgccatgcattgccgc
gcggtgatcgagcgtttcggcatgcgccccgacgactgtgagctgcacttctattcgatc
aacttcgacgccgccaccgagcgtttgctggtgccgctgctcagcggcgcgcacgtggtg
ttgcgcgcgcaagggcaatgggacgcggaagaaatctgcggcctgatccgtcgtcatcag
atcaacgtactcggtttcacgcccagctacggcagccagttggcgcaatggctggcgacc
caggaccagaccctgccggtgcgcatgatcatcaccggcggcgaggcgctgaccggtgag
cacctggcgcgtattcgtgcagcgttcaagccgagccggttcttcaacgcctacggcccg
accgagaccgtggtcatgccgctggccagccttgctcccgaagtgctggaagagggcgcc
ggcagcgtgccgatcggcagtgtgatcggcgaccgcgtggcctacattctcgacgccgac
ctggcgttggtgccgcaaggcgcgacgggcgagttgtatgtcggtggcgcgggtctggcc
cagggttatcaccagcgcccgggcatgacggcggagcgctttgtggccgatccgtttgcc
gccgatggcgggcgtatctaccgcaccggtgacctggtgcgccagggtgccgatggcctg
gtggaataccttggacgcatcgaccatcaagtgaagattcgcggattccgcatcgagctc
ggtgaaatcgaaacccgcctgctggaccatgattcagtccgtgaggcggtcgtgctggcg
cttgacgcaccgagcggcaagcaactggtcggctacctggtgacggatgtcgccgaacag
gacgaagcgcagcaatcgatgttgcgcgaggccctcaaggcgcatctgaaatcgcaactg
ccggattacatggtgcccacgcacctgatcctgctggcgagcatgccgttgaccggcaac
ggtaaactcgaccgccgtgcgctcccggcaccggacccggagctgaatcgccaagattat
gtggcgccaagcaacgagctcgaagtcacgctggcgcagatctggtgcgacgtgctgaac
gtcgagcaggtcggtctcaacgacaatttcttcgaactgggcggtgactcgatcctgtcg
atccaggtggtcagccgggcgcggcagcagggcattcacttcacccctcgcgatctgttc
cagcaccagaccgtgcagaccctcgccgccgtggccacccgcagcgagcagatcagcgcc
gagcagggcttgatcttgggcgagtcgcgcctgacaccgatccagcactggttcttcgac
accgacatcgcgcaacgccaacactggaaccaggcgctgttgttgcaaccgacggtggtg
ctggaatctcatcgcctggagcaagcgttgctggcggtgatcgaacagcacgacgccttg
cgcctgcgctttggcaaggatgccggccagtggcaggccttgcaccagccgatttccgat
gcgccggtgttgtggcaagtgcgtgtttcgtccatggataaatgcgcggccttgttcgcc
gatgcccagcgcagtctcgaccttgaacagggacccttactgcgcgtgttgctggtcgat
ggccctgaaggccagcaacgcttgtttatcgccattcaccacctggtggtggacggtgtg
tcgtggcgggtgctgctcgatgacctgcaaaccctgtatcgccaactggaagcacgtcag
tcggtgaaactgccggcgaaaaccagcgccttcaaggactgggctgcacgcttgcaagcc
tacgccggcagcgagtccctgcgcgaagagctgggctggtggcaggcgcaactggccggg
ccaagtgccgatttaccctgcgatcaccctgaaggcgggcggcaaaaccgtcatgcgcaa
accgtcagcgtgcgtcttgacagcgagcgtacgcggcagttgctgcaacaggcgccaagt
gcctatcgcacccaggtcaacgacttgctgttgactgctttggcccgcgttttgtgccgc
tggagcggtcagccatcggcgctgatccagctggaaggccacggccgcgaagcgctgttc
gacgacatcgacctgacccgcaccgtgggctggttcaccagtgcctatccgttgcgcctg
acgccgtcgaacatcgaagaagtcgccgggcagggggcctcgatcaaggcgatcaaggaa
cagctgcgtgccgtgccgcacaagggcctgggttatggcgtgctgcgttacctcgccgat
gagccgattcgccgcagcatggcgacgttgccgcaggcaccgattaccttcaactacctc
ggccagttcgaccagagcttcggcgcggacgcgctgttccatccactggatgaagccgtc
ggcgcggcccacgatgcccatgcaccgttgcccaacgagctgagcgtcgacagtcaggtg
tatggcggtgaactggtattgcgctggacgttcagcgccgaacgcttcgatccgtccacc
atcggcgagttggccgatgcctacctcggtgagctgagcagtctaatcgagcattgcctg
cgcgacgacgccggcggcctgacgccgtcggacttcccgctggcgcagctcaatcagacg
caactggatgcgttgccggtgccggccgccgttatcgaagacgtctacccgctgaccccg
atgcaggaaggcatgctgttgcacaccttgctggagccaggcaccggcctgtactacatg
caggaccgctaccgcatcaacagcgaactggatccgcagcgtttcgcccaggcctggcaa
gccgtagtcgcccgccacgaagcgttgcgcgcgtcgttctgctggaacgtcggcgaggac
atgctgcaggtgatccacaaaccgggcagcacaccgatcgagtacctcgactggcgtgat
atcgcccaagccgagcaagagccgaagctgcaagccttgctcaagaccgaacgcgaggcg
gggttcgatctgctcaaccaggcgccgttccacttgcgcctgatccgtgtggacgcggcg
cgctattggttcatgatgagcaaccaccacatcctcatcgatgcctggtgccgttcgctg
ctgatgaacgatttcttcgagatctacagcgccctcggcgaaggccgggaagcgcagctt
gggcctgtgtcgcgttatcgcgactacattggctggctgcaacgccagagcctggacgaa
gcgcggcaatggtggaaaaccagcctgcaggggtttgagcggaccacgccgatcccgagc
gaccggccgttcctgcgtgaacatgccggcgacagtggcggcatgatcgtcggcgaccgc
tacacccggctcgatgcccgggacggtgcgcaattgcgcgaactggcccaggcccatcag
ttgaccatcaacaccttcgcccaggcggcgtgggcgctggtgctgcggcgcttgagcggt
gatcgcgacgtgctgttcggcgtcaccgtggccgggcgtccggtggagatgccgcagatg
caacgcaccgtcggcctgttcatcaacagcatcgcgctgcgggtgaagatgcccgaggac
ggtcagcgatgcagcgtgcgccagtggctcagcggactgctcgacagcaacatgcaactg
cgtgaatacgaatacctgccgctggtgaacatccaggagcaaagcgagctgcccaagggc
caaccgctgttcgacagcctgttcgtgttcgaaaacgccccggtggaagtctcggtgctg
gaccgtgcgcagagcctcaacgcgacctcggattcgggccggacccacaccaacttcccg
ttgacggccgtgtgctatccgggggatgacctgggcttgcacctgtcctacgaccagcgc
tacttcgatgaagccacggtcgagcgcatgcttggcgagttcaagcgtttgctgttggcg
ttggtggaaggtttccatggcgacatggccgacctgccgttgctgggggccgaggagcag
gacttcctcctccatggctgcaaccagagcgaacacgaatatccactgcagcagagctac
gtttcattgtttgaaactcaggtcgcccgacacccgcagcggattgccgccagttgtctt
gatcggcagtacagttatctggaactgaaccagcgcagtaaccgtctcggtcatgcgttg
atcgccgccggcgtcgggcgcgatcaaccggtggcattgctggccgaacgcagtctcgat
ctgctgggcatgatcatcggcagcttcaaggccggcgcgggttacctgccgctggacccg
ggcctgccgagccagcgtctgagccggatcatcgaactgagccgaacgccactgctggtg
tgcacgcaagcgtgccgtgaacaggcgcaggccttgcttgacgagttcggctgcgccagc
cggccacggctgctggtctgggaggaggtccaggcccttgcgctgtcggcggacaatccc
ggcatctacagcagtgcggacaacctggcctatgtgatctacacctccggttccaccggt
ttgcccaaaggcgtgatggtcgagcagcgcggcatgctcaacaaccagctgagcaaagtg
ccgtatctggacctgagcgacgccgacgtgatcgcccagaccgcctcgcaaagcttcgac
atttccgtgtggcagttcctcgccgcgccgctgttcggcgcacgggtggacatcgtgccg
aacaccatcgcccacgatccgcagggtttgctggcgcatgttgcggcccagggcatcacc
gtgctggaaagcgtgccatcgctgatccagggcatgctcgcccaggagcgcatgagcctc
gacggcctgcgctggatgctgccgaccggtgaggcaatgccgccggaactggcgcaccaa
tggttgctgcgttatccgcagatcggcctggtgaatgcctacggtccggcggagtgctcg
gacgacgtggcgttcttccgtgtcgacctggcctcgacccgcggcagctatttgccgatc
ggtacgccgaccgacaataacctgttgtatgtgctcgatggcgcactggaactggtgccg
ctgggtgccgtgggtgaactgtgtgtcgccggcaccggggtcgggcgcggttatgtcagc
gacccgctgcgcacggctccggtgtttgtgccgaacccgttcggcgcgcccggcgagcgc
ctgtatcgcaccggcgacctggcccgccgtcgcagtgacggcgtgctggagtacgtgggg
cgcatcgaccatcaggttaagattcgtggttaccgcatcgagctgggtgaaatcgaggct
cgcctgcatgaacaaccggaagtccgcgatgcggcggtgggtgtgcaggaaggggcgaac
ggcaagcatctggtgggctatctggtcgcggcgcaggtggcgtcgagtccggccgaggga
ttggagcggatcaagcaacgcctgcgcgccgaattgccggaatacatggtgccgctgcac
tggctgtggctggacaagctgccgctgaacgccaatggcaaactggatcgcaaggccttg
ccggcgctggagatcggccagatgcagagccaggattaccaggcgccgcgcaatgacctg
gagcagaccctggcggacatctgggctgaagtgttgaaggtcgagaaggtcggcgttcgc
gacaacttcttcgaactgggcgggcattcgttgctggccacgcagatcgcctcacgggtg
cagaaatccctgcaacgtgacgtgccgttgcgggcgatgttcgagtgcagcacggtgcag
gagttggccggttacatcgacggattggcggccagcgagatcaccgaggagaaggtggat
cgcttgaatgacctgatggcggagctggaggggttgtaa

DBGET integrated database retrieval system