KEGG   Pseudomonas putida W619: PputW619_1390Help
Entry
PputW619_1390     CDS       T00675                                 

Definition
(GenBank) glycosyl transferase group 1
Organism
ppw  Pseudomonas putida W619
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_trans_1_2 Glyco_trans_4_2
Motif
Other DBs
NCBI-ProteinID: ACA71895
UniProt: B1J5R7
LinkDB All DBs
Position
1521841..1523460
Genome map
AA seq 539 aa AA seqDB search
MKVLVISNFFPPHVIGGAEIIAHHQARALAARGHEVRVLAGDNSRGLPGYPVEQEVFDGM
PVTRVSLTYLDFAPTGNNVAHPGVERIFLRLIAQWRPDVIHAHHMAGLSLGILQLAREHG
IRIALTLHDHWGFCMNSTRITTQDTLCQDSTQCHKCHSHIYNGDLLLPQRMRQDYLRWQL
DAVDHFISPSRYLADTYIANGLPAARMNVIANGIELERFSHTSPPPPGPRLNVLFTGYMG
GHKGVPTLLKALALLPPERVHVDMVGDGHMLETYKAELRNNAPKVSAKFWGRLPNARIAE
RFAQAHVFVLPSVCPENQPVTITEAMSCGLAVVGSRIGGIPELVDEGVTGQLFDHGDAQA
LARCLLRYIEEPAVLEAHGKAGRERIQAYAFELQIDRIEALLAGPGAERSEAPQLIACHG
APSAETFQSVLKALCPVPANRPQPASQPCCIPSNWIAPEQADVLWVAGPTAQDPDAAMKL
IEAYRALGKQVVVDERHLLVARNTESALLARGGAQVALSLEYLLEYARDPEAQTAPTQA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttcttgtcatatccaatttcttcccgccccatgtgatcggcggtgcagaaatc
atcgctcaccaccaggcccgcgcgctggctgcgcgtggtcatgaagtgcgcgtgctggca
ggggacaacagccgtgggctgcctggctacccagtggagcaggaggttttcgacggcatg
ccggttacccgggtgtcgttgacctatctggactttgccccaaccggcaacaacgtcgcg
caccccggcgtcgaacgtatctttctgcgcctgatcgctcaatggcgccccgatgtgatc
cacgcgcaccacatggccgggttgtccttgggcatcctgcagttggcgcgtgagcatggg
atccgcattgcgctgaccttgcacgaccactgggggttctgcatgaacagcacgcgcatc
accacccaggacaccttgtgccaagacagcacccaatgccacaaatgtcattcgcacatc
tacaacggtgacctgctgctgccgcaacggatgcgccaggactacctgcgctggcaattg
gatgctgttgatcatttcatttcacccagccgttacctggccgacacctacatcgccaac
ggcctgcctgccgcgcgtatgaatgttatcgccaacggtatcgaactcgagcggttcagc
cacacctcaccgccaccgcccgggccgcgcctgaatgtgctgttcaccggctacatgggt
ggccataaaggcgtacctaccttgctcaaggcgctggcattgctgccgccagagcgggtg
catgtcgacatggtcggtgacggccatatgcttgaaacctacaaagccgaactgcgcaac
aatgcgccgaaggtttctgccaagttctggggcagactgcccaatgcgcgtatcgccgag
cgcttcgcccaggcgcatgtgttcgtgctgccatcggtgtgcccggaaaaccaacctgtg
accattaccgaggcgatgtcctgtggcctggcggtggtgggttcacggataggcggcata
cccgagctggtggatgaaggcgtgaccggtcagttgttcgaccacggcgacgctcaagcg
ctggcgcgctgcttgctccgttacatcgaagagccggcggtgttggaagcccatggcaag
gcgggtcgtgagcgcatccaggcctatgccttcgagctgcagatcgaccgtatcgaagcc
ttgctggccggccctggcgccgaacgtagcgaggccccacaactgatcgcatgccatggc
gctccatcggctgaaaccttccagagcgttctcaaggcgctgtgcccggttcctgccaac
cggccgcagcctgccagccagccctgctgcattccctcgaactggattgcgccagagcaa
gcagatgtactgtgggtggcggggccaacagcccaagacccggacgccgcgatgaagctc
atcgaagcttaccgcgccttgggcaaacaggttgtggtggatgagcgccatctgctggtt
gcgcgcaacacggagtcagccttgctggcgcgcggcggcgcgcaggtagcgttaagcttg
gaatacctcttggagtacgcgagggatcctgaggcacaaactgccccaacccaagcctga

DBGET integrated database retrieval system