KEGG   Paenibacillus polymyxa E681: PPE_01587Help
Entry
PPE_01587         CDS       T01319                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy00020  Citrate cycle (TCA cycle)
ppy00480  Glutathione metabolism
ppy01100  Metabolic pathways
ppy01110  Biosynthesis of secondary metabolites
ppy01120  Microbial metabolism in diverse environments
ppy01130  Biosynthesis of antibiotics
ppy01200  Carbon metabolism
ppy01210  2-Oxocarboxylic acid metabolism
ppy01230  Biosynthesis of amino acids
Module
ppy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppy_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPE_01587
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PPE_01587
Enzymes [BR:ppy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PPE_01587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ADM69426
UniProt: E0RD20
LinkDB All DBs
Position
1695827..1697122
Genome map
AA seq 431 aa AA seqDB search
MAKFEKFELPTEGEKITIDNGQLQVPNHPVIPFIEGDGTGRDIWKASKRVLDAAVEKAYN
GSKKIAWYEVFAGEKAFNTYGEWLPNDTLEAIREYIVAIKGPLTTPIGGGIRSLNVALRQ
ELDLYVCLRPVRYFNGVPSPVKRPELVDMVIFRENTEDIYAGIEYAEGSEDVKKVIQFLQ
QELGVNKIRFPETSGIGIKPVSSEGSKRLVRAAIQYAVDHGRKSVTLVHKGNIMKFTEGA
FKNWGYEVAEEEFADKVFTWAQYDVIKEKDGEDAANAAQKAAEDAGKIIIKDAIADIALQ
QVLTRPSEFDVIATLNLNGDYLSDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKY
ADKDVVNPGSVILSGVMLLEHLGWKEAADLIYKGLETSINKKIVTYDFARLMDGATQVKC
SEFADTIISNL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatttgaaaagtttgagctcccaactgaaggcgaaaaaattacgattgataac
ggtcaactacaggttccgaaccatccggtaattccgtttatcgaaggtgacggcacgggt
cgcgacatctggaaagcctccaagcgcgtactggacgcagctgtagaaaaagcatataac
ggcagcaaaaaaattgcctggtatgaagtattcgctggtgagaaagctttcaatacatac
ggcgaatggctccctaacgatactttggaagccatccgtgagtatattgtagccattaaa
ggtccgcttacgacacctattggcggtggtatccgttcgttgaatgtggcattgcgtcag
gaactggatttatacgtatgtctgcgtcctgttcgttattttaacggtgttccttctcca
gtgaaacgtcctgaattggtagatatggttattttccgtgagaacacagaagatatttac
gcggggatcgagtatgctgaagggtccgaagacgtgaaaaaggttattcagttcctccag
caagagctgggtgtgaacaaaatccgtttccctgaaacctctggtattggcattaaacca
gtttcttccgagggttcaaagcgtctggtacgggcagccattcagtatgctgttgatcac
ggacgcaagagtgtaacgctcgtacacaaaggtaacattatgaaatttaccgagggtgct
ttcaaaaactggggttatgaagtggctgaggaagaatttgcagataaagtatttacttgg
gcccaatatgatgtaatcaaggaaaaagacggtgaggatgcggctaatgcagctcaaaaa
gcagctgaagatgcaggcaaaatcattatcaaggatgcgattgctgatatcgcacttcag
caagtactgactcgtccttctgaatttgatgtgattgctacgctcaacctgaacggggac
tatctgtccgatgctcttgctgcccaagttggtggcattggtattgcgccaggtgcaaac
attaactatgtaacagggcatgctatctttgaagctacacatggtacagcaccaaaatac
gccgacaaagatgtagtgaaccctggttccgtcattctgtcgggcgtaatgttgcttgaa
cacttgggttggaaagaagcggctgacctgatttacaaagggctggagacgtccattaat
aagaagattgtaacttatgactttgctcgtctgatggatggtgctacacaagtgaaatgc
tccgagttcgcagataccattattagtaacctgtaa

DBGET integrated database retrieval system