KEGG   Paenibacillus polymyxa E681: PPE_01587Help
Entry
PPE_01587         CDS       T01319                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPE_01587
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PPE_01587
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PPE_01587
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    PPE_01587
Enzymes [BR:ppy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PPE_01587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1695827..1697122
Genome map
AA seq 431 aa AA seqDB search
MAKFEKFELPTEGEKITIDNGQLQVPNHPVIPFIEGDGTGRDIWKASKRVLDAAVEKAYN
GSKKIAWYEVFAGEKAFNTYGEWLPNDTLEAIREYIVAIKGPLTTPIGGGIRSLNVALRQ
ELDLYVCLRPVRYFNGVPSPVKRPELVDMVIFRENTEDIYAGIEYAEGSEDVKKVIQFLQ
QELGVNKIRFPETSGIGIKPVSSEGSKRLVRAAIQYAVDHGRKSVTLVHKGNIMKFTEGA
FKNWGYEVAEEEFADKVFTWAQYDVIKEKDGEDAANAAQKAAEDAGKIIIKDAIADIALQ
QVLTRPSEFDVIATLNLNGDYLSDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKY
ADKDVVNPGSVILSGVMLLEHLGWKEAADLIYKGLETSINKKIVTYDFARLMDGATQVKC
SEFADTIISNL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatttgaaaagtttgagctcccaactgaaggcgaaaaaattacgattgataac
ggtcaactacaggttccgaaccatccggtaattccgtttatcgaaggtgacggcacgggt
cgcgacatctggaaagcctccaagcgcgtactggacgcagctgtagaaaaagcatataac
ggcagcaaaaaaattgcctggtatgaagtattcgctggtgagaaagctttcaatacatac
ggcgaatggctccctaacgatactttggaagccatccgtgagtatattgtagccattaaa
ggtccgcttacgacacctattggcggtggtatccgttcgttgaatgtggcattgcgtcag
gaactggatttatacgtatgtctgcgtcctgttcgttattttaacggtgttccttctcca
gtgaaacgtcctgaattggtagatatggttattttccgtgagaacacagaagatatttac
gcggggatcgagtatgctgaagggtccgaagacgtgaaaaaggttattcagttcctccag
caagagctgggtgtgaacaaaatccgtttccctgaaacctctggtattggcattaaacca
gtttcttccgagggttcaaagcgtctggtacgggcagccattcagtatgctgttgatcac
ggacgcaagagtgtaacgctcgtacacaaaggtaacattatgaaatttaccgagggtgct
ttcaaaaactggggttatgaagtggctgaggaagaatttgcagataaagtatttacttgg
gcccaatatgatgtaatcaaggaaaaagacggtgaggatgcggctaatgcagctcaaaaa
gcagctgaagatgcaggcaaaatcattatcaaggatgcgattgctgatatcgcacttcag
caagtactgactcgtccttctgaatttgatgtgattgctacgctcaacctgaacggggac
tatctgtccgatgctcttgctgcccaagttggtggcattggtattgcgccaggtgcaaac
attaactatgtaacagggcatgctatctttgaagctacacatggtacagcaccaaaatac
gccgacaaagatgtagtgaaccctggttccgtcattctgtcgggcgtaatgttgcttgaa
cacttgggttggaaagaagcggctgacctgatttacaaagggctggagacgtccattaat
aagaagattgtaacttatgactttgctcgtctgatggatggtgctacacaagtgaaatgc
tccgagttcgcagataccattattagtaacctgtaa

DBGET integrated database retrieval system