KEGG   Cutibacterium avidum: PALO_04650Help
Entry
PALO_04650        CDS       T02632                                 

Gene name
kgd
Definition
(GenBank) alpha-ketoglutarate decarboxylase
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
pra  Cutibacterium avidum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pra00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PALO_04650 (kgd)
  Amino acid metabolism
   00310 Lysine degradation
    PALO_04650 (kgd)
   00380 Tryptophan metabolism
    PALO_04650 (kgd)
Enzymes [BR:pra01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     PALO_04650 (kgd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1024806..1028603)
Genome map
AA seq 1265 aa AA seqDB search
MSPAPHDKSNNSADFGANDWLIEEMRDQYQNDPSSVDPAWATFFHHEAAQASDEVTGLAV
GEQPARQDPKPEPAPNPVANQKPAPAAKAEAKPAPKPAASTAPTPTPKVKDMASKPEPSK
TSREPARPLLTADAPRHSAKLETVEPTVTKMKGAPMRTAKNMDQSLTMPTATTVRDVPMQ
LVIEQRTMINNFLRKAKGGKISFTHILAYAMVQALKTVPAMNNAYAEIDGKPHLIENHQI
NLGMAIDVVNKDGSRKLVVPAIKGAEQMDFLDFWRAYEEIVRKGRTNELTIEDFKGVTAS
LTNPGGFGTNHSIARLMPGQGMILGVGSIDYPAAYQGNSPTRMAELGISKVTTLTSTYDH
RIIQGAQSGEFLRRMHQLLLGADRFYENIFESLRIPYAPVQWASDRQANRPDQVGKQARV
IELIDSWRRFGHLSADIDPIEYRPRFHHDLMLNSHGLTLWDMDRTFPIANFAGQRRATMT
LREILTILRDSYASTMGIEYMHIADHEQRKWFQDRFEKEHQPLSREMHLQILDQLNEAEI
FETFLQTKFVGQKRFSLEGGESAIVLLAALCNLAADDSLNEVCIGMPHRGRLNVLANIIG
KSYGQIFREFEGNAEPVNSQGSGDVKYHLGDEGEFTAASGNTIKASVAANPSHLEAVDPV
LEGICRAKLDALGNPDNFPVLPILMHGDAAFSGQGVVYETLQMSQLEGYRTGGTIHVIVD
NQVGFTTSPRDGRSSTYCTDVAKAVGAPVLHVNGDDPAAVVHAARIAYEYRQIFHRDVVI
DVVCYRRRGHNEGDDPSFTQPHMYDLIAEKRSTRKLYTESLIGRGDITDEDAHAVMSKFR
SRLETVFKEVREATSRPEPYSGVPDYPVKHSGLHLTTVEVDTLEAVARAHENLPETFNAH
PKVAPQMTRRAKHIREGGIDWATGEMIALGSLLREGIHVRLAGQDSRRGTFSQRFAALVD
RATGEFYVPVNHLGGEQAHLDVLDSPLNEYAAMGFEYGYSVARPDSLVLWEAQFGDFVNG
AQTIIDEFIASAGSKWGQKSGVVLLLPHGYEGQGPDHSSARLERFLNLCSEGALAVCQPS
TPASYSHLLRQHAYVNRHRPVVIATPKSMLRNKMATSDPEEFTTGKWRPVLPDPSITDPS
AVTRIILCSGKVRWELVKQRKAAGLDGQLAIIPLERLYPLPDKELAEVLEPYSNVTDVRW
VQEEPENQGAWYYILTHLAQAMSDKLPGFFDGLTAVTRPPSSAPSVGQHSVHVREEQELL
EKAMA
NT seq 3798 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcccgccccacacgacaagtccaacaactctgctgattttggagccaacgactgg
ctcatcgaggagatgcgtgaccagtaccagaatgatccgagttcggtcgatcctgcttgg
gccacattttttcaccacgaggcggcccaggcgtccgatgaggtgactggattggcagtc
ggcgaacagcccgctcgtcaggatcccaagcctgaaccggctcctaatcccgtcgccaat
cagaagcctgctccggctgcgaaggccgaagccaagccggctcccaaacccgctgcatca
accgcccccaccccgacaccgaaggtcaaggacatggcatcgaagcccgaaccatcaaag
acctcccgcgagcctgcccgtcctcttctgacggctgacgccccgcgtcacagcgccaag
ctggaaaccgtcgagcccacggtgacgaagatgaagggtgcgccgatgcgcaccgccaag
aacatggatcagtcgctgaccatgccgacggccaccacggtgcgtgacgtgccgatgcag
ctcgtcatcgagcagcgcacaatgatcaacaacttccttcgcaaggccaagggcggcaag
atctccttcacccacatcctcgcctatgcgatggtgcaggcactcaagaccgttccggcg
atgaacaacgcctatgcggagatcgacggcaagcctcacctcatcgagaaccatcagatc
aacctcggcatggccatagacgtcgtcaacaaggacggctcccgcaaactcgtggtgccc
gccatcaagggcgccgagcagatggacttcctcgacttctggcgtgcctacgaagagatc
gtccgcaagggtcgcaccaatgagctgaccatcgaggacttcaagggagtcacggcctcc
ctgacgaaccccggcggtttcggcaccaaccactccattgcccgcctcatgcctggtcag
ggcatgatcctcggcgtcggatcgatcgactacccagctgcctaccagggcaactccccc
acccgtatggcggagctgggcatctccaaggtgacgaccctcacctctacctacgatcac
cgcatcatccagggcgcccagtccggcgaattcctgcgtcgcatgcaccagctgctcctg
ggtgctgatcgcttctacgagaacattttcgaatccctgcgtatcccctacgctccggtc
cagtgggcgagcgaccgtcaggccaaccgccccgaccaggtcggcaaacaggctcgcgtc
atcgaactcatcgactcctggcgtcgcttcggccatctgtccgccgacatcgatcccatc
gagtaccggccgcggttccaccacgacctcatgctcaacagccacggcctcaccctgtgg
gacatggaccgcaccttcccgatcgcgaacttcgccgggcagcgtcgcgccaccatgacc
ctgcgtgagatcctcacgatcctgcgtgactcctacgcctcgacgatgggcatcgagtac
atgcacatcgctgaccacgagcagcgcaagtggttccaggatcgtttcgagaaggagcac
cagcccctctcccgcgagatgcacctgcagatcctcgaccagctcaatgaggccgagatc
ttcgagaccttcctgcagaccaagttcgtcggtcagaagcggttcagcctcgagggtggc
gagtcggccatcgtcctgctggccgcactgtgcaacctggctgccgacgacagcctcaac
gaggtctgcatcggcatgcctcaccgtggtcgtctcaacgtgctggccaacatcatcggc
aagtcctacgggcagatcttccgtgagttcgagggcaatgccgagccggtgaactcccag
ggatcgggtgacgtcaagtaccacctcggtgacgagggtgagttcaccgcagcctccggc
aacaccatcaaggcgtcggttgccgccaacccgagtcacctcgaagccgtcgatcctgtc
ctcgagggcatctgccgggccaaactcgacgctctgggcaacccggacaacttcccggtc
ctgccaatcctcatgcatggtgatgctgccttctcgggtcagggtgtcgtctacgagacc
ctgcagatgagccagctcgagggataccgcaccggtggcacgatccacgtcatcgtcgac
aaccaggtcggattcaccacctcgccccgtgacggacgttcctcgacctactgcaccgac
gttgccaaggccgtcggggccccggtcctgcacgtcaatggagatgaccccgccgcggtg
gtccacgctgctcgtattgcctacgagtatcgccagatcttccaccgtgacgtcgtcatc
gacgtggtctgctaccgccgccgcggccacaatgagggtgacgatcccagcttcacccag
ccgcacatgtacgacctcatcgctgagaagcgttcgacccgaaagctctacaccgagagc
ctcatcggtcgtggtgacatcaccgacgaggacgcccatgccgtgatgtcgaagttccgg
tctcgcctcgagacggttttcaaggaggtccgtgaggccacctcgaggcccgagccctac
agcggcgttccggactacccggtcaagcacagtggcctgcatttgaccacggtcgaggtt
gacaccttggaggccgtcgcccgggctcatgagaacctgccggagaccttcaacgcccat
cccaaggttgcccctcagatgacgcgtcgtgccaagcacattcgagagggtgggatcgac
tgggcgaccggcgagatgatcgccctgggctccttgctgcgtgagggcatccacgtccgc
ctggccgggcaggacagccgccgcggcaccttctcgcagcgcttcgcggccctggtagat
cgtgcgaccggagagttctacgtgcccgtcaaccacctcggtggcgagcaggcgcacctg
gacgtcctcgactccccgctgaacgaatacgcggcgatgggcttcgagtacggatactcg
gtcgcccgtccggactccttggtgctgtgggaggcccagttcggtgacttcgtcaacgga
gcccagacgatcattgacgagttcatcgcctcggcaggttcgaagtgggggcagaagtcc
ggcgtcgtcctgctgctcccccacggctatgagggccagggaccggaccattcctcggcc
cgcctggagcgcttcctcaacctgtgcagtgagggagccctggctgtctgccagccctcg
accccggcgagctacagccacctgctgcgtcagcatgcctacgtcaacaggcaccgaccg
gtcgtcatcgctactccgaagtccatgctgcgtaacaagatggcgacctctgacccggag
gagttcaccactggcaagtggcgcccggttctgcccgatccgtccatcactgatccgtcg
gccgtcaccaggatcatcctctgctcaggcaaggtgcgttgggaactcgtcaagcagcgc
aaggccgccgggctcgacggtcagctggccatcatcccgctggagcggctctacccgctt
ccggacaaggaactggccgaggtactcgagccctacagcaacgtcactgacgttcgttgg
gtgcaggaggagccggaaaaccagggtgcctggtactacatcctcactcacctggcccag
gcgatgtccgacaagctgcctggcttcttcgatggcctgaccgccgtgacacgtccgccg
tcctcggctccctcagtgggccagcacagtgtgcatgtccgcgaggagcaggagctgctc
gagaaggccatggcctga

DBGET integrated database retrieval system