KEGG   Pieris rapae (cabbage white): 110991776Help
Entry
110991776         CDS       T05162                                 

Definition
(RefSeq) pyrimidodiazepine synthase-like
  KO
K00310  
pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
prap  Pieris rapae (cabbage white)
Pathway
Glutathione metabolism
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:prap00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    110991776
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    110991776
Enzymes [BR:prap01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     110991776
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 254 aa AA seqDB search
MSEKHLKKGDALPPYNGKLRLFAMRFCPYAERSILVLNAKKLQYDLVHIDLDNKPEWIFS
FNPKGTVPILEYEEGKAIFDSSIINAYLDEKYPEPPLQSSDPLQRAHDKIVVELLSSAHS
AYYTAAFNAQALTSESLETYHRGLEVLQKEVESRGTTFLGGDKPGLVDYTIWPFLERFLS
LPQLGKPEFAISEDKYAALLKYMESMKNDPPVKAYSLAPETHAKYTESRVKGTPDNNMLD
TSDVCCFRPRKKKE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagaaacacttaaagaaaggagatgccctgccgccgtacaatggtaaattacgg
ttatttgctatgagattttgtccctatgcagaacgaagtatcttggttttaaatgccaaa
aagttacagtatgatttagttcatatcgatctggataacaaaccagaatggattttcagc
tttaatcctaaaggtacagtgccaattttggaatatgaagaaggtaaagctatatttgac
agcagcattattaatgcctatcttgatgagaaatatcctgagccacctctacaatcttca
gaccctctgcaacgggcacatgacaagatagttgttgagcttctatctagtgctcactca
gcatattatactgcagcatttaacgcccaagctctgacatcagagtcgttagagacatac
caccgtgggctagaagttctgcaaaaggaagtggaatctagaggcactacattcttaggt
ggtgataaacctggcttggtggattatactatttggccatttttggagcgctttttgtca
cttcctcagttaggcaaacccgaatttgctattagtgaggataaatatgctgcattattg
aaatatatggagtcaatgaaaaatgaccctccagtcaaggcctacagcttagctccagaa
acccacgccaagtataccgaatctcgcgtaaagggtacaccggacaataacatgctagac
actagtgatgtctgctgcttccgtccacgtaagaagaaggaatga

DBGET integrated database retrieval system