KEGG   Pieris rapae (cabbage white): 110997817Help
Entry
110997817         CDS       T05162                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETD2 isoform X1
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:prap00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    110997817
Enzymes [BR:prap01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     110997817
Chromosome [BR:prap03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110997817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET WW MIP-T3
Motif
Other DBs
NCBI-GeneID: 110997817
NCBI-ProteinID: XP_022121830
LinkDB All DBs
Position
Unknown
AA seq 1339 aa AA seqDB search
MAKKKKPANVASRRSARRGKPIQKGAIEGETSTSVEQPATAPASEDPPPETKETTSGPTS
SDTNAKPPQELPYVVLHKKFGKYRCLFNNDDTFTKKYDVGSDSETNSSFEIRVVDPGISS
ESDSNAAVDTQSDTNSGACPSPMNIPDRALHSFSSRDASPLPSVESLDIPLPNDNTIENK
KDFDNACDGKEMCSPIDDQENNQANEVHNEDQVQLFNEHLYGDDDEVITIVQILDDENQE
GYYNIDIDTSKDQELSENDKRENENQDIEFQKDFEKLNLVPTLNPTSPMQYCEDVIRNSN
CVTPDLQFPKENLERPDPSLTPSSTISDDSNSSRATDQVQNNSNDSAESSPSGVRRSNRI
KTISTLKQKTKGYGLVRNTLKKTLITQTKLKLEESGSESQDKPTDVLNQSSTDPPPFPVP
TEMPVKVKSRWRRSSELEMGANSPSISPLASPSLPKLPAIEEKQHVEEVKEVVALSKEAY
DRIIEERMNQYQHLDENEYLCDRMISRDTKKMICDCFMTKEELERGELACGEDCLNRLLM
IECNSRCPVGDRCTNRRFQKKENGALKVFYAEKKGCGVEASANVPAGEFLMEYVGEVLDY
EQFYKRAQAYSDENNLHHYFMSLKGDTVIDATVKGNISRFINHSCDPNAETQKWTVNGEL
RIGFFSKRDITIGEEITFDYQFQRFGKVAQRCYCGTENCRGWIGAEPDSEDEDYEEDGDV
STSKFTAESEEMQTTEDKAKPRVRRPRRDRSYKPSADLVQDADIEEDLEALSRTGVKNQS
HTLRLSRTVVRAKTRRAQAALLRLLRDADLPCRRLFLDYRGLRLLAPWCTDAPLDFKLEM
LQTVDRLPIPNKTMVQETRFFTIIERWLSSSELPPEPPVFIDEATGLPVELGSRPAPEVD
KAKENAAVLEKIKDLSSQLLERWSSLKEVFKIPKKERIQQMKEHERQANVERRAADSSGS
RDRDRDRDRDRDRDRERERDRERREERDRDRDREREREREREKERDRYRERDRERERDRD
RRKRRSSPEGRRSIRLTDRVLAAIPPMSKEERRRAFAEAAAAADESRRQRDSQSFMPYWP
PDSFSQMFPQGMIPGQPTIMPNGPNMMPNRPPMLPNGPNMLPNGPNMMPNGPNLMGPNML
PGPQNMLSGPQNMMGAPNLMMPGLMPGMIPGDVPPEWIGPNGEFQGPPGFCPPFPGQPFC
VPQPNVMGMSGFGVGGFMFGQQMGPFPPQASRPGNAPQPMVTESVNTEDDDDVEPVLPSM
WRSALDDRGRRYYYHVKLRQPQWLPPPQPPPSPDESSSEEEADPLSAMETAVVRRQMKGK
MVEGVNGIYEVSFVLIPLQ
NT seq 4020 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaaaaagaaaccagcaaatgttgcctctcggcgttccgcgcggcgtgggaag
cctattcaaaagggtgcgatcgaaggtgaaacctccacttcggtggaacaacctgccact
gcacctgcttcagaagacccgcctcctgaaactaaagaaaccacaagtggaccgacttct
tctgacacaaatgctaaaccacctcaagaactgccttatgtagttctgcacaagaagttt
ggtaaatatcgatgtttgtttaataatgatgatacattcacaaagaaatatgatgttggt
agtgacagtgaaactaatagtagctttgagataagagttgtagatcctggtataagctcc
gaatcagattccaatgctgcagttgatactcagtctgatacaaatagcggtgcttgtccc
agtcctatgaacattccagatcgtgcattgcatagttttagttctagagatgcatctcct
ctgccttcagttgaaagcttagatatacctttgccaaatgacaatacaatagaaaataaa
aaggactttgacaatgcatgtgacggaaaagaaatgtgttcaccaatagacgaccaagaa
aacaatcaggccaatgaagtacacaatgaagatcaagttcaattgtttaatgagcatctt
tatggtgatgatgatgaagtgataactatagttcaaatattagacgatgaaaatcaagag
ggttattataatatcgatattgatacttcaaaggatcaagagctaagtgaaaatgacaaa
agagaaaatgaaaatcaagatattgaatttcaaaaagattttgaaaagcttaatctagta
ccaacattaaatcctacttctccaatgcagtattgtgaagatgttatcagaaattcaaat
tgtgttactccagatctacagtttcctaaagagaatttggaaaggcctgatccaagttta
acaccaagctcaactatatctgatgatagcaactcttctagggcaacagaccaggtgcag
aacaattcaaatgattccgcagagtcttctccatcaggtgttcgaaggtctaacagaata
aaaacaataagtacattaaagcaaaagactaaaggttatggtttagtgagaaatacactg
aaaaaaacattgataacacaaacaaaactaaaacttgaagagtcagggtccgaaagccaa
gataagcctactgatgtcttaaaccaatccagtactgatcctcctccatttcctgttcca
acagaaatgcctgttaaagtcaaatctagatggcgacgttcaagtgaacttgaaatgggg
gctaattcaccatcaatttctccattagcaagcccaagtttaccaaaactacctgctatt
gaagagaaacagcatgttgaagaagtgaaagaagtcgttgctctgagtaaggaagcatat
gatagaataattgaagaaagaatgaaccagtaccaacatttggatgaaaatgagtattta
tgtgatagaatgataagtcgggatacaaagaagatgatttgtgactgttttatgaccaaa
gaagagttggagagaggagaacttgcttgtggagaagactgtttgaatagactccttatg
attgaatgtaattcaagatgtcctgttggagatagatgtacaaatagacggtttcagaag
aaagagaacggtgctctaaaagtgttttatgctgaaaaaaaggggtgtggtgtggaagct
agtgctaatgttccagcaggtgaatttctaatggaatatgtgggtgaagtgctagattat
gaacaattctacaaaagggcccaagcctactccgatgaaaataacctccaccactatttc
atgtcactcaaaggcgataccgtaattgatgctacagttaagggaaacatctcgcgtttt
ataaatcattcatgcgatccaaatgcagaaactcagaaatggacggtcaatggagaactg
agaataggatttttcagtaagcgagatattacaattggggaagaaataacatttgactac
cagtttcaaagatttggcaaagtggcgcaaaggtgttactgtggcactgagaattgtagg
ggctggatcggggctgaacctgattcagaggatgaagattacgaggaggatggagacgtg
tctacgtccaagttcacagctgagtctgaggagatgcagacgacagaagacaaagcgaag
ccccgagtgcggaggccaagaagagatcgcagttataaacctagtgctgacttagtccag
gatgctgatattgaagaagatctggaagccctcagtcgcaccggagtcaagaatcagagt
catacacttcgcctatcgcgtacagtcgtccgcgctaagacgcgccgcgcgcaggccgca
ctactgcggctcttacgcgacgctgacttaccttgtcgccgactgttcttggactatcgc
gggctaaggctgttagcgccgtggtgtactgatgcgccgttggactttaaattggaaatg
cttcaaacagtggatagattgccaatccccaacaagaccatggtgcaagagacacgcttc
ttcacaatcattgagagatggctcagctcttcagaactgccaccggagccgcctgtcttc
attgatgaggctactggtctacccgttgaactaggaagcagaccggctccagaagtagat
aaggcgaaggagaatgctgctgtgcttgagaaaattaaggatctctcatcacagctttta
gagaggtggtctagtctcaaagaagtctttaaaatcccaaaaaaagaaagaatccagcag
atgaaagaacacgaacgtcaagcgaatgttgaaaggcgagctgcggactccagtgggtca
cgcgaccgtgaccgcgaccgcgaccgtgatcgtgatcgcgatcgtgaacgcgaacgcgac
cgtgagagacgcgaggaacgtgaccgtgaccgcgatcgagagagggagagggagagggaa
cgtgaaaaagagagggatagatatagggagagggatcgagagagggaaagagatagagat
aggcggaaaagaagaagcagtccagaggggaggcggagtattcgacttacagaccgagtg
ctagctgctattccaccaatgagcaaagaggagaggcgtcgggccttcgcagaagcggct
gcagcggctgatgagagcaggcggcagagggacagtcagtcattcatgccttactggcca
ccggattcattctcacagatgttcccacaaggaatgattcctggacaacccactataatg
ccaaatggaccaaacatgatgccaaacagaccaccgatgttacccaatggcccgaatatg
ctacccaatgggcctaatatgatgccaaacggaccaaacctaatgggtccaaacatgtta
ccagggccgcagaatatgttaagtggtccacaaaatatgatgggggccccgaatcttatg
atgccgggtctcatgcctggtatgataccaggtgatgtgcccccggaatggattgggccg
aatggagagtttcagggtcctcctgggttttgtccgccgtttccggggcagccattttgt
gtgccacaacccaatgtgatgggaatgagtgggttcggtgtgggtgggttcatgttcggt
cagcagatgggaccctttccacctcaagcatccagacctggaaatgcacctcagcccatg
gtgacagagagtgtgaatacagaggatgatgatgacgtggagccagtgttgccgtccatg
tggaggagtgccttggacgacagaggccggaggtattactaccacgtgaagctgaggcag
ccgcagtggctgccaccacctcagccgcctccgtcaccagatgaaagttcttctgaagag
gaagcagaccctttgagtgcaatggagacggccgtagtacgaaggcagatgaagggcaag
atggtggaaggtgttaatggaatttatgaggtctcatttgtgttaataccgttgcagtga

DBGET integrated database retrieval system