KEGG   Pseudomonas resinovorans: PCA10_15840Help
Entry
PCA10_15840       CDS       T02708                                 

Definition
(GenBank) glutathione S-transferase family protein
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
pre  Pseudomonas resinovorans
Brite
Enzymes [BR:pre01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     PCA10_15840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_3 GST_C_2 DUF2397
Motif
Other DBs
NCBI-ProteinID: BAN47316
UniProt: S6AT41
LinkDB All DBs
Position
complement(1697377..1698027)
Genome map
AA seq 216 aa AA seqDB search
MIDLYYWTTPNGHKVSLFLEEAGLPYRIHPINIGKDEQFQPHFLKISPNNRIPAIVDQQP
ADGGEPLSLFESGAILLYLAEKTGRFIPQDLRGRQECLQWLFWQMGGLGPMAGQNHHFNR
FAPEKLPYAIQRYMKETARLYGVLDKRLADRTFVAGAEYSIADMAIYPWIDRHAWQEQDL
EDFPNLKRWYLGIQARPATVRAYALVEQVNPAAVKK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctgtactactggaccacccccaacggccacaaggtcagcctgttcctcgaa
gaagccggcctgccctaccgcatccacccgatcaacatcggcaaggacgagcagttccag
ccgcacttcctgaagatttcgccgaacaaccgcatccccgccatagtcgaccagcagccc
gccgacggcggcgagccgctgtcgctgttcgaatccggcgccatcctcttgtacctggcg
gaaaagaccggccgcttcatcccgcaggacctgcgtggccgccaggagtgcctgcaatgg
ttgttctggcagatgggcggcctcggcccgatggctgggcagaaccaccacttcaaccgc
ttcgccccggaaaagctgccctacgccatccagcgctacatgaaggaaaccgcgcgactg
tacggcgtcctggacaagcgcctggccgaccgcacctttgtcgccggcgccgagtacagc
atcgccgacatggccatctacccctggatcgaccgccacgcctggcaggaacaggacctg
gaggatttccccaacctcaagcgctggtacctgggcatccaggcgcgcccggccacggtc
cgcgcttacgctctggtggagcaggtgaacccggccgccgtgaaaaagtaa

DBGET integrated database retrieval system