KEGG   Pseudomonas resinovorans: PCA10_30800Help
Entry
PCA10_30800       CDS       T02708                                 

Definition
(GenBank) pyoverdine synthetase
Organism
pre  Pseudomonas resinovorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3387346..3400317)
Genome map
AA seq 4323 aa AA seqDB search
MMEVFDLPGTLVEALQRRAAAEPERIALRFLTEDQGTGEVLDYRQLDQRARSIAAALQQR
TVAGDRAVLLFNSGTDYVASFFACLYAGVIAVPAYPPESNRHHHLQRLHSILDDAQPRLV
LTSSGLEIQLQTALGEQSASLLCVDRLDRQLAEGFQPVALAADDIAFLQYTSGSTSLPKG
VEVSHGNLVANEKLIRHGFGIGADDVIVSWLPLYHDMGLIGGLLQGIWSGVPVVLMAPQY
FLERPLRWLEAISRYGGTVSGGPDFAYRLCCERISESAMARLDLSGWRLAFSGSEPIRQD
SLDAFAARFTAAGFDRGAWYACYGLAEATLFVSGARRGQGINIRELDAEALAANRAERGN
GATAISCGFPQPEHPLLLVDPQQGNVLEEGQVGEIWVSGASIAKGYWRNPEASARTFVQR
DGRTWLRTGDLGFVLEGELHVTGRLKDMLIVRGHNLYPQDIERTVETEVEMVRKGRVAAF
AVQHQGREAIGIAAEIGRRVQKMVPPDILVRMVRQAVAEAHQESPAVVVLLNPGALPKTS
SGKLQRSACRTQLDDASLDHYALFRDGEAIRQPGSEPAPAADGRVAQLWREQLDVTELSA
GDNFFALGGNSIRAVQVIARLREELGVALDMRQLFEAPTLGEFSALVERLVAEGGQARDS
IARLDRRQPLAQSAAQNRLWFLWQLDPQSAAYNIPGALRLRGNLDEAALTRTFEQLVARH
EALRTSFFEVDGQALQRIHLAGAFQLRLVDLEGQPNAEAQALALREADALAPFDLEQGPP
LRVSLVRIAERDHLLLVTLHHIIADGWSLNLLLDEFSRLYGAHGLGQPAELPALPLQYAD
LAAWQNQWLAAGEGARQLDWWKAQLGDEHPLLLLPTDRPRTPDARYRAGRYGIRLDKALA
ERLQQLARDHDASLFMLLLAGWQALLHRYSGQRDIRLGVPGANRARLESHGLIGFFINTL
VLRGELDTRMPFAALLAQARQATLGAQAHQQLPFEQLLEACPEARAQGGLFQVMFNHQQR
DQRALQRLPGLSAEALPWNSLDAKFELQLQSEEDERGRISLSFDYAVELFDEATIARLAS
HFQRLLWQVAERPELAIGDIQLLGDTERSQLAVWGSAPRERARCWLPELIAEQVALGAER
PLLLGAQPLTLGEVDARANRLAHRLRALGVGPEVRVGICAERSSEMLLGLLAILKAGGAY
VPLDPDYPRERLAYMAEDSGIRLLLTQSWLAAPALPAGVQRLDLDQADVADLPATAPALE
LHGESLAYVIYTSGSTGKPKGVGVTHAALAERLLWMRDTYGFGAADVFMQKAPVSFDVSV
WECFLPLLCGSRLLLAAPGEHRDPARLVARVREHGVTVLHFVPALLQLFVEEPGLADCSS
LRLLFSGGEALSAELRERVFERLPAVSLHNRYGPSETTINVSHWHCQAGEGASVPIGRPL
GNVQCQVLDDNLEPVVPGVAGELCIGGLGLARGYLGRPGLSAERFVPNPDGSGTRLYRTG
DLARWRADGVLEYLGRVDQQVKLRGFRIELEEIEACLLAQAGVRQAVVVLRDSQAGPQLV
GYLVADGADEEALLARLKDALQQALPDYMVPAHLLRLDAMPLSPSGKLERKALPEPQWRQ
RAHRAPQSAVEQRLAAIWSEVLGVARVGLDDDFFELGGHSLLATQIVSRSRQAFDIELPL
RALFDASRLAAFASRVEQALATGQRDSQGAIARVDRSLPQALSYSQQRMWFLWQMEPGSP
AYNVGGVARIGGALDADRFEAALQALIARHETLRTTFPSVAGVPQQRVSDDAGLPIQHHD
LSHLPAESFQARLEAFADAEAHQPFDLERGPLLRAHLVKAEAQVHYLVVTLHHIVTEGWA
MDIFARELAELYAAQLEGRDAELAPLPVQYLDYSQWHRQWLEGGEMQRQLDYWQAQLGGE
QPLLELPADRPRPPVQSHQGDLLRFDLDDALAARVRAFNAEHGLTMFMTMTAALGLLLYR
YSGQDDLRIGAPVANRIRPESEGLIGAFLNTQVLRVQPRGLMSVRELLEQVRQVAIEAQS
HQDLPFDHLVEALQPQRSAAYNPLFQVMCNVQRWEFQQTRDVAGLKLEYIANDARATKFD
LNLEVTDLDERLGCCLTYSCDLFDRPRIARMAEHWQNLLRAMLDTPDARLAELPLFAAEE
SAALLAAHRQGTDAYPLEGTVQQLFERQALATPDAPALTFAGQTLGYAELNARANQLARR
LVELGVGPEVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLDRLRYMVEDSGIALL
LGHAALLDALGELPLGVQGWCVERDSAALAGYARDNLAPRSGAEHLAYVIYTSGSTGQPK
GVGVAQGAIAMHLRAVIADFGMRSDDCELHFYSINFDAASERLLAPLLCGARVVLRAQGQ
WGAEDICGLIREQGVTILGFTPSYGCQLAQWLGGRGEQLPVRLCITGGEALTPEYLQGIR
AAFAPQRFFNAYGPTETVVMPLASLAPEQLDATASSVPIGKVVGARALYVLDADLNLLPP
GATGELYVGGEGLARGYHQRPSLTAERFVADPFGGQGGRLYRTGDLVRQRNDGLIEYVGR
IDHQVKIRGFRIELGEIEARLQALPGVREAVVLALDSPSGKQLVGYLLAEDATLASADGE
RQAAFREQLKTQLKALLPDYMVPPHLVLLERMPLTANGKLDRKALPAPDLEQGRQAYAAP
RSPREEQLAAIWREVLNLEQVGIHDNFFELGGDSILSIQVVSRARELGIHFTPKDLFRFQ
TVQSLAEAAQDGPRKEAAAIEQGPLSGNAGLTPIQHWFFDGRVAGLDHWNQALLLEPTQP
LEPHLLERALERLLEQHDALRLGFSANASGWSAAYRAPETAQGLLWQRQVKDADERLALF
ESAQCSLDIGQGPLLRAVLAEGPGDQRRLLLAIHHLVVDGVSWRVLLEDLQSLYRQLAEG
REPKLPAKTSALGDWSARLAAYASSESLREEQAWWQTQLAGPSAEPPRQDANGDNSEGHA
RSVTLRLDASHTRALLQQAPAAYRTQVNDLLLTALARVLCRWIGSDSVLVQLEGHGREAL
FDEIDLTRSVGWFTSAYPLRLTPAASLGESIKAIKEQLRAVPHKGLGHGVLRYLADAGLR
QAMAALPQARITFNYLGQFDQSFGADALFRPLEEAAGAQHDPASPLPNWLSVDGQVYGGE
LQLRWTFSERLFAPAAIERLAADYQAELQAVLAHCLEDAAGGVTPSDFPLAHLSQAQLDS
VALAPQEIADIYPLTSMQEGLLLHTLLEPGSGIYFMQDRYTINSAIDFPRFAAAWHAVID
RHEALRASFWWNSGENMQQVIHRRSTTAIELLDWSAEPEEGHEQRLRDLLKAEREAGFNL
LEEAPFRLRLIRLNDACHWFIMSNHHILIDAWCRSLLMGDFLEIYGALGEGREVRLPTPP
RYRDYIAWLQQQDARAAADFWRDNLRGFERASYIPSDRPFLRDNGAMLVGDRIIRLKVEE
GARLRELAQRHQLTINTFAQAAWALVLRRYGGERDVLFGVTVAGRPVAMPEMQRTVGLFI
NSIPLRVPMPAVGERRSVRDWLQSLLEHNLALREYEYLPLVKVQECSELPKGQPLFDSLF
VFENAPVEVSVLDRAQSLSASSESGRTHTNFPLTVVCYPGDDLGLHLSYDRRFFEEATID
TLLGEFKRLLLALAEHIGSDFAELPLLGDEERGFLLQGCNSTERAYPLDQGYVRLFEAKV
AEHPHKPVATCQGQAWNYDTLNRRANRLGHALVAAGVRVDQPVALLGERSLDLLGMMVGA
FKAGGGYLPLDPGHPAQRLVDILERSRAPALVCSRACETQARELLEGLNCANRPRLLVWE
TVQEGAANEGDLGIHSGPQNLAYIIFTSGSTGQPKGVMVEQAGMLNNQLSKVPYLALGED
DVIAQTASQSFDISVWQFLTAPLCGGQVDIVPNAIAHDPLALLAHVRSRGITVLESVPSL
IQGMLAEEALDLSGLRWMLPTGEAMPPELARQWLQRYPAIGLVNAYGPAECSDDVALFRV
DLAATEGTYLPIGTPTDNNRLYLLDAELQPVPLGAVGELCVTGTGVGRGYAGDPLRSAQV
FMPDPFGAPGERLYRTGDLARRRLDGVLEYVGRIDHQVKIRGYRIELGEIEARLHAHPEV
RDGAVAVQDGITGKQLVGYVVPVDPQVDAAGLRERLKQALKAVLPDYMVPLHWLQLPELP
HNANGKLDRKRLPALDIGQSQGAFQAPRNELEDSLAGIWREVLKVERVGVTDNFFELGGH
SLLATQIASRVQKTLQRNVPLRAMFECATVEELARYIESLEDSAISEQKASRLDDLMASL
EAL
NT seq 12972 nt NT seq  +upstreamnt  +downstreamnt
atgatggaagtgttcgatctcccaggcaccctggtggaggcgctgcagcgtcgcgctgcg
gcggagccggaacgtatcgcgctgcggttccttaccgaggaccagggcacgggtgaggtg
ctcgactaccgccagctcgaccagcgcgcccgcagcatcgccgccgcgctgcaacagcgg
accgtggccggggatcgtgccgtgctgctgttcaacagcggcacggactacgtcgccagc
ttcttcgcctgcctgtatgccggcgtgatcgcggtgccggcctatccgccggaatccaac
cgccaccatcacctgcaacgcctgcattccatcctcgacgacgcgcagccgcgcctggtg
ctcacctccagcggcctggaaatccagttgcagaccgctctcggcgagcagtccgccagc
ctgctctgcgtcgatcgcctggaccggcaactggccgagggcttccagccggtggcgctg
gccgccgacgacatcgccttcctgcagtacacctccggttccacctcgctgcccaagggt
gtcgaggtcagccacggcaacctggtggccaacgagaagctcattcgccacggctttggc
atcggcgccgacgacgtgatcgtcagctggctgccgctctaccacgacatgggcctgatc
ggcggcctgctgcagggcatctggagcggcgtgccggtggtgctgatggcgccgcagtat
ttcctcgagcgtccgctgcgttggctggaagccatcagccggtacggcggcaccgtcagc
ggcggcccggacttcgcctatcgcctgtgctgcgagcgcatcagcgaatcggccatggcg
cgcctcgacctgtccggctggcgcctggccttctccggctccgaaccgatccgccaggac
agcctcgacgccttcgccgcgcgcttcaccgccgccgggttcgaccgtggcgcctggtac
gcctgctacggcctggccgaggccaccctgttcgtcagcggcgcgcgccgtggccagggc
atcaatattcgtgaactggacgctgaggcgctggccgccaatcgcgccgaacgcggcaac
ggcgccactgccatcagctgcggcttcccccaacccgagcacccgctgctgctggtggac
ccgcagcagggcaatgtcctggaagaagggcaggtgggcgagatctgggtgagcggggcg
agcatcgccaagggctactggcgcaacccggaggccagcgcgcgtaccttcgtccagcgt
gacggccgcacctggctgcgcaccggcgacctgggcttcgtgctggagggcgagctgcac
gtcaccggccgcctgaaggacatgctcatcgtccgcggccacaacctctacccgcaggac
atcgaacgcaccgtcgaaaccgaggtggagatggtgcgcaagggccgggtggccgctttc
gccgtgcaacaccagggccgcgaagccatcggcatcgccgccgagatcggtcgccgtgtg
cagaagatggtgcccccggacatcctcgtgcgcatggttcgccaggccgtggccgaagcc
catcaggaaagccccgccgtggtggtgttgctcaaccccggcgcgctgcccaagacctcc
agcggcaagctgcaacgctccgcctgccgcacccagctggacgacgccagcctcgaccac
tacgcgctgttccgtgacggcgaggccattcggcaaccaggcagcgagccggcgccggcc
gccgatggccgggtggcgcagctctggcgcgaacagctggacgtgaccgagctcagtgcc
ggcgacaacttcttcgccctgggcggcaactccattcgcgcggtgcaggtcatcgcccgc
ctgcgggaagagttgggtgtggccctggacatgcgccagctgttcgaggcaccgaccctg
ggcgagttctccgccctggtggagcgcctggtggccgaaggcggccaggcccgggacagc
atcgcccgactcgaccgccgccagcccctggcccagtccgccgcgcagaaccgcctctgg
ttcctctggcagctggacccgcagagcgccgcctacaacatccccggcgccctgcgcctg
cgcggtaacctggacgaggcggcgctcacccgtaccttcgagcaactggtggcccgccac
gaagccctgcgcaccagcttctttgaggtggatggccaggcgctgcagcgcatccatctg
gccggtgcgttccagctcaggctggtggacctggaaggccagccgaacgccgaggcgcaa
gccctggccctgcgcgaagccgatgccctggcccccttcgacctggaacagggcccgccg
ctgcgggtcagcctggtgcgtatcgccgagcgcgaccacctgctgctggtgaccctgcac
cacatcatcgccgacggctggtcgctgaacctgctgctggacgagttctcccgcctctat
ggcgcccacggcctcggccagccagcggagcttccggcactgccgctgcaatacgccgac
ctcgccgcctggcagaaccagtggctggcggcgggcgagggcgcccgtcagctggactgg
tggaaggcccagctgggcgacgagcacccgctgctcctgctgcccaccgaccgaccgcgc
accccggacgcgcgctatcgcgccgggcgctacggcatccgcctggacaaggccctggcc
gaacgcctgcagcagttggcccgcgaccacgacgccagtctgttcatgctcctgctggcc
ggctggcaagccctgctgcaccgctacagcggccagcgggacatccgcctgggcgtgccc
ggcgccaaccgtgcgcgcctggaaagccacgggctgatcggcttcttcatcaataccctg
gtcctgcgcggcgagctggacacgcgcatgcccttcgcggcgcttctggcccaggcacgc
caggccaccctgggcgcccaggcacaccagcagctgcccttcgagcaactgctcgaggcc
tgccccgaggcccgcgcccagggcggcctgttccaggtcatgttcaaccaccagcaacgg
gaccagcgcgccctgcaacgcctgcccgggctgtcggccgaggcgttgccctggaacagt
ctggacgccaagttcgagctgcaactgcaaagcgaggaagacgaacgcgggcgcatcagc
ctgtccttcgactacgccgtggagctgttcgacgaagccaccatcgcgcgcctggccagc
cacttccagcgcctgctctggcaagtggccgagcggccggaactggccatcggcgatatc
cagctgctgggcgacaccgagcgctcgcagctcgccgtctggggcagcgccccccgcgag
cgcgccaggtgctggctgccggagctgatcgccgaacaggtggcgctgggcgccgagcgc
ccgctgctgctgggtgcccaacccctgaccctgggtgaagtggatgcccgcgccaaccgc
ctggcccatcgcctgcgcgccctgggcgtcggccccgaggtgcgcgtggggatctgcgcc
gagcgttccagcgagatgttgctgggcctgctggccattctcaaggccggtggcgcctat
gtgccgctggacccggactacccccgcgagcgcctggcctacatggccgaggacagcggc
attcgcctgctgctgacccagagctggctggccgccccggcgctgccggccggagtgcag
cggctggacctggaccaggcggacgtcgccgatctgccggccaccgcgccggcactggag
ctgcacggcgaaagcctcgcctatgtcatctacacctccggctccaccggcaagcccaag
ggcgttggcgtgacccacgcggccctggccgagcgcctgctgtggatgcgcgacacctac
ggcttcggcgccgccgatgtgttcatgcagaaggccccggtgagcttcgacgtttcggtc
tgggaatgcttcctgccgctgctctgcggcagccgcctgctgctggccgcccccggcgag
caccgggacccggcgcgcctggtggcgcgggtgcgcgagcacggggtgaccgtgctgcac
ttcgtgccggcgctgctgcagctgttcgtcgaggagcctggcctggccgactgctccagc
ctgcgcctgctgttctccggcggcgaggcgctgtcggcggagctgcgcgagcgggtcttc
gagcgactgccggcggtgagcctgcacaaccgctacggccccagcgaaaccaccatcaac
gtcagccattggcattgccaggcgggcgagggcgcctcggtgcccatcggccgcccgctg
ggcaacgtgcagtgccaggtgctcgacgacaatctcgaacccgtggtgcccggtgtggcc
ggggaactctgcatcggcggcctgggcctggcccgtggctacctcgggcgccccgggctg
tcggccgaacgcttcgtgcccaacccggacggcagcggcacgcgcctctaccgcaccggc
gacctggcgcgctggcgcgctgacggggtactggagtacctcggccgtgtcgaccagcag
gtgaagctgcgcggtttccgcatcgagctggaagaaatcgaagcctgcctgctggcccag
gccggcgtgcgccaggccgtggttgttctgcgcgatagccaggccggtccgcagctggtt
ggctacctggtggccgacggcgccgacgaggaagccctcctggctcgcctgaaggacgcc
ctgcagcaagccctgccggactatatggtgccggcgcacctgctgcgcctggacgccatg
ccgctgtcgccgtccggcaagctggagcgcaaggccctgcccgaaccccagtggcgccag
cgcgcgcaccgggcgccgcaatcggcagtggaacaacgcctggcggccatctggagcgag
gtgctgggcgtggcccgggtcggtctggatgacgacttcttcgaactgggcggccactcc
ctgctggccacccagatcgtttcccgcagccgccaggccttcgacatcgaactgccgttg
cgcgccttgttcgacgccagccgccttgccgccttcgcctcgcgtgtggagcaggccctg
gccacggggcagcgcgacagccagggcgccatcgcccgggtcgaccgcagcctgccgcaa
gccttgtcctattcccagcagcgcatgtggttcctctggcagatggagccgggcagcccg
gcctacaacgtgggcggtgtggctcgcataggcggcgcgctggatgccgaccgcttcgag
gccgccctgcaggcgctgatcgctcgtcacgaaaccctgcgcaccactttccccagcgtg
gcgggcgtgccgcagcagcgggtgtccgacgacgccggcctgcctatccagcaccatgac
ttgtcgcacctgccggccgagtcgttccaggcgcgcctggaggccttcgccgatgccgag
gcgcaccagcccttcgacctggagcgggggccgctgctgcgggcccacctggtcaaggcc
gaggcccaggtgcattacctggtggtgaccctgcaccacatcgtcaccgagggctgggcg
atggacatcttcgcccgcgaactggccgagctctacgccgcccagcttgaaggccgtgac
gccgagctggcgccgctgccggtgcagtacctggactacagccagtggcaccgccagtgg
ctggaaggtggcgagatgcaacgccagctggactactggcaggcccagttgggcggcgag
cagccgctgctggaactgcccgccgaccgcccgcggccgccggtgcagagccaccagggc
gacctgctgcgcttcgacctggacgacgccctggccgctcgcgtgcgcgccttcaacgcc
gagcatggcctgaccatgttcatgaccatgaccgccgccctcggcctgctgctgtatcgc
tacagcggccaggacgacctgcgcatcggcgcaccggtggccaaccgcatccgcccggag
agcgaagggctgatcggtgccttcctcaatacccaggtcctgcgggtacaaccccgtggc
ctgatgagcgtgcgcgagctgctggaacaggtgcgccaggtggccatcgaggcgcagtcc
caccaggacctgcccttcgaccacctggtggaagccctgcaaccccagcgcagcgccgcc
tacaacccgctgttccaggtgatgtgcaacgtccagcgctgggagttccagcagacccgt
gacgtcgccggcctgaagctcgagtacatcgccaacgacgcccgtgccaccaagttcgat
ctgaacctggaagtcaccgacctggacgagcgcctgggctgctgcctgacctacagctgc
gacctgttcgaccgcccgcgcatcgcgcgcatggccgagcactggcagaacctgctgcgg
gccatgctcgatacgccggatgcacgcctggccgagctaccgctgttcgccgccgaggaa
agtgccgcgttgctggccgcccatcgccagggcaccgatgcctatccgctggagggcacg
gtgcagcaactgttcgagcgccaggccctggccacgccggacgccccggcgctgaccttc
gccgggcagaccctcggctacgctgaactcaacgcccgcgccaaccagctggctcgccgc
ctggtggagctgggcgtgggaccggaagtgcgggtcggcctggccctggagcgctccctg
gaaatggtggtggggctgctcgccatcctcaaggccggtggcgcctatgtgcccctggac
ccggaatacccgctggaccgcttgcgctacatggtggaggacagcggcatcgccttgctg
ctcggccatgccgcgctgctggacgccctgggcgaactgcccctcggcgtgcagggctgg
tgcgtggagcgcgacagcgcggccctggccggctacgcccgcgacaacctggctccgcgt
agcggcgccgagcacctggcctacgtcatctacacctcgggttccaccggccagcccaag
ggcgtcggcgtggcccagggcgccatcgccatgcacctgcgggcggtgatcgccgacttc
ggcatgcgcagcgacgattgcgagctgcacttctattccatcaacttcgacgccgccagc
gaacgcctgctggcacccttgctgtgcggtgcgcgggtagtgctgcgggcccagggacag
tggggcgccgaggacatctgcgggctgatccgcgagcagggcgtgaccatcctcggcttc
acccccagctatggctgccagctggcccagtggctgggcgggcgcggcgagcaattgccg
gtgcgcctgtgcatcaccggtggcgaggcactcacccccgagtacctgcagggcatccgc
gcggccttcgcgccgcagcgtttcttcaacgcctatggccccaccgaaaccgtggtcatg
ccgttggccagcctggcaccggaacaactggatgcgaccgcgagcagtgttcccatcggc
aaggtggtgggcgcccgcgccctctacgtgctggacgccgacctcaacctgctgccgccg
ggtgccaccggcgagctctacgtgggcggcgaaggcctggcccgtggttaccaccagcgt
ccgagcctcaccgccgagcgcttcgtcgccgatcccttcggcggccagggtggtcgcctg
taccgcaccggcgacctggtgcgccagcgcaacgacgggctgatcgagtacgtcgggcgc
atcgaccatcaggtgaagattcgcggcttccgtatcgaactcggcgagatcgaggcgcgc
ctgcaagccttgccgggcgtacgcgaggccgtggtactggccctggatagcccctccggc
aagcaactggtgggctacctgctggccgaggacgcgaccctggccagcgccgatggcgaa
cgccaggcggccttccgcgaacaactgaagacccagctcaaggcgctgctgccggattac
atggtgccgccgcacctggtgctgctggagcgcatgcccctgaccgccaacggcaagctg
gaccgcaaggccctgccggcgccggacctggagcagggccgccaggcctatgccgcgccg
cgcagcccgcgtgaggaacaactggccgccatctggcgcgaggtgttgaacctcgaacag
gtgggcatccacgacaacttcttcgaactgggcggtgactccatcctctccatccaggtg
gtgagccgagcgcgggaactgggtatccacttcacgcccaaggacctgttccgcttccag
accgtgcagagcctcgccgaggcggcccaggacggcccgcgcaaggaggccgccgccatc
gagcagggcccgctgagcggcaatgccgggctgacgcccatccagcactggttcttcgac
ggccgcgtggccggcctggaccactggaaccaggcgctgctgttggaacccacccaaccc
ctggagccgcacctgctggagcgcgccctcgaacggctgctggaacagcacgacgccctg
cgcctgggcttcagcgccaatgccagcggctggagcgccgcctaccgcgcgcctgaaacc
gcccagggcctgctctggcagcgccaggtgaaggatgccgacgagcgcctggcgctcttc
gaaagcgcccagtgcagcctcgacatcggccagggcccgctgctacgcgccgtgctggcc
gaagggccgggggatcaacgccgcctgctgctggccatccatcacctggtggtggatggg
gtgtcctggcgcgtactgctggaagacctgcagagcctctaccggcaactggctgaaggc
cgcgagccgaaactgccggccaagaccagtgccctcggcgactggagcgcgcgcctggcg
gcctacgccagcagcgaatccctgcgcgaggagcaggcctggtggcaaacccagctcgcc
ggcccatccgccgagccgccacgccaggacgccaacggcgacaacagcgaaggccatgct
cgcagcgtgaccctgcgcctggacgccagccatacccgcgcattgctgcaacaggcgccg
gcggcctaccgcacccaggtcaacgacttgctgctgaccgccctggcccgcgtgctgtgc
cgctggatcggcagcgactcggtgctggtccagctggagggccatggccgcgaggcgctg
ttcgacgagatcgacctgacccgcagcgtcggctggttcaccagtgcctacccgctgcgc
ctgaccccggccgccagccttggcgagtcgatcaaggcgatcaaggaacagctgcgcgcg
gtgccccacaagggcctcggccacggtgtgctgcgctacctggccgacgccgggttgcgc
caggccatggccgcgctgccccaggcgcggatcaccttcaactacctgggccagttcgac
cagagcttcggcgctgacgcgctgttccgcccgctggaagaagcggccggcgcccagcac
gacccggcctcgccgctgcccaactggctcagcgtcgatggccaggtctacggcggcgag
ctgcaactgcgctggaccttcagcgagcggctgttcgcgccggccgccatcgaacgcctg
gcggcggactaccaggccgagctgcaggcggtcctggcccattgcctggaggatgccgcc
ggtggcgtcacgccgtcggacttccccctggcgcacctgtcccaggcgcaactggacagc
gtcgccctggcgccccaggaaatcgccgacatctacccgctcacctccatgcaggagggc
ctgctgctgcacaccctgctggagccgggctcgggcatctacttcatgcaggaccgctac
accatcaacagcgccatcgacttcccgcgtttcgccgccgcctggcacgcggtgatcgat
cgccacgaagcgctgcgcgcctcgttctggtggaacagcggcgagaacatgcagcaggtc
atccatcgccgcagtaccacagccatcgagttgctggactggagcgccgagcccgaggaa
ggtcacgagcaacgcctgcgcgacctgctcaaggccgagcgcgaggccggcttcaacctg
ctggaggaagcgccgttccgcctgcgcctgatccgcctgaacgatgcctgccactggttc
atcatgagcaaccaccacatcctcatcgatgcctggtgccgttcgctgctgatgggcgac
ttcctggaaatctacggcgccctgggcgaaggtcgcgaggtacggctgccaacgccgccg
cgctaccgcgactacatcgcctggctgcaacagcaggacgcccgcgccgccgccgatttc
tggcgcgacaacctgcggggcttcgagcgcgccagctacatccccagcgaccggcccttc
ctgcgggacaacggcgccatgctggtgggcgaccgcatcatccggctcaaggtggaggag
ggcgcacgcctgcgggagctggcccagcgtcaccagctcaccatcaacaccttcgcccag
gcggcctgggccctggtgctgcgccgctacggcggcgagcgcgacgtgctgttcggtgtg
accgtggccggacgcccggtggccatgccggaaatgcagcgcacggtggggctgttcatc
aacagcattccgctgcgggtgccgatgccggccgtgggtgagcgccgcagcgtgcgcgac
tggttgcagtcgctgctggagcacaacctggcgctgcgcgagtacgaatacctgccgctg
gtgaaggtgcaggagtgcagcgaactgcccaagggccagccgctgttcgacagcctcttc
gtgttcgagaacgcccccgtggaagtctcggtgctggaccgcgcccagagcctgtcggcc
agttcggagtcgggccgtacccacaccaacttcccgctcaccgtggtctgctacccgggc
gacgacctcggcctgcacctgtcctacgaccggcgcttcttcgaggaagcgaccatcgac
acgctgctgggcgagttcaagcgcctgctgctggccctggccgagcacatcggcagcgat
ttcgccgaattgccgttgctcggcgatgaggaacgcggcttcctgctgcagggctgcaac
agcaccgagcgcgcctatcccctggaccagggctatgtgcgcctgttcgaagccaaggtg
gccgagcacccgcacaagccggtcgccacctgccagggccaggcctggaactacgacacg
ctgaaccgccgcgccaaccgcctggggcacgccctggtggcggccggggtgcgcgtcgac
cagccggtggcgctgctgggcgaacgtagcctggacctgctgggcatgatggtcggcgcc
ttcaaggcgggcggcggctacctgccgctggacccgggccacccggcccagcgcctggtc
gacattctcgaacgcagccgcgcgccggccctggtctgcagccgcgcctgcgagactcag
gcccgcgagctgctggaaggcctcaactgtgccaatcgcccgcgcctgctggtgtgggag
acggtgcaggagggcgcggccaacgagggcgacctgggcatccacagcggcccgcagaac
ctcgcttacatcatcttcacctcgggctccaccgggcagcccaagggggtgatggtggag
caggccggcatgctcaacaaccagctgagcaaggtgccctacctcgccctcggcgaagac
gacgtgatcgcccagaccgcttcgcagagcttcgatatctcggtctggcagttcctcacc
gcaccgctttgcggcggccaggtggacatagtgcccaacgccatcgcccatgatcccctg
gcgttgctggcccatgtgcgttcccgtggcatcacggtgctggagagcgtgccgtcgctg
atccagggcatgctcgccgaggaggcgctggacctgtccggcctgcgctggatgctgccc
accggcgaagccatgccgccggaactggcgcgccagtggcttcagcgttacccggccatc
ggcctggtgaacgcctacggcccggcggaatgctcggacgacgtggcgctgttccgcgtc
gacctggcggccaccgaaggcacctacctgcccatcggcacgcccaccgacaacaaccgt
ctctacctgctggacgcggaactgcaaccggtgcccctgggcgcggtgggcgaactctgc
gtgaccggcaccggggtgggccgtggctatgccggcgacccgctgcgcagtgcccaggtg
ttcatgcccgaccccttcggggcgccgggtgagcgcctgtaccgcaccggcgacctggcg
cggcgccgcctggacggcgtgctggagtacgtcgggcgcatcgatcaccaggtgaagatc
cgtggctaccgcatcgagctgggcgagatcgaggcacggctgcacgcccatcccgaggtg
cgcgacggcgcagtggcggtgcaggacggcatcaccggcaagcagctggtgggctatgtg
gtgccggtggacccgcaggtggacgcggccgggctgcgcgagcggctcaagcaggcgctc
aaggcggtgctgccggactacatggtcccgctgcactggctgcaactgcccgaactgccc
cacaacgccaacggcaagctcgaccgcaagcgcctgccggccctggacatcggccagagc
cagggagccttccaggcgccgcgcaacgagctggaagacagcctcgccggcatctggcgc
gaggttctcaaggtggagcgggtaggggtgaccgacaacttcttcgaactgggcgggcac
tcgctgctggccacgcagatcgcctcgcgggtgcagaagaccctgcaacgcaacgtgccg
ctgcgggccatgttcgagtgcgccacggtggaggagctggcgcgctacatcgaatcgctg
gaagacagcgccatcagcgaacagaaggccagccggctggacgacctgatggcgagcctg
gaagcgctctga

DBGET integrated database retrieval system