KEGG   Poecilia reticulata (guppy): 103456618Help
Entry
103456618         CDS       T05149                                 

Gene name
tmprss7
Definition
(RefSeq) transmembrane protease serine 7
  KO
K09638  
transmembrane protease serine 7 [EC:3.4.21.-]
Organism
pret  Poecilia reticulata (guppy)
Brite
Enzymes [BR:pret01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     103456618 (tmprss7)
Peptidases [BR:pret01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103456618 (tmprss7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
AA seq 1762 aa AA seqDB search
MSTKGKETEQTKGNDGDRPHQDSASIADVSVEVATVDHTLRKLCRMYRKSRRKPKGLKRL
WAYLLNVPHITTITAAVLFVVVVIIWSLLWVFIFRRESYSGAYFAGMFRVANVEFIPEYR
QAESHEFVSMATKIQQVVSSVYRTSSVARLYKQVVISDLSNNNKGGVLVHFWMVFIVPQM
KTTAMREDFIEAILRDSINTNLKNRSSVGFLHELPVDMDSILINGVQRSDYSSNTADSQC
VDKLYANLPGASVPLNVYSSWGGVNCHVKLTAVPSSLIRLTVTSFLIEPTDCVNDALTVY
DALLPMRGRILHRLCEPVSSSFSIVSTSNVMLLSFRMTSDSKSFNGHFEAVAEQICMSQI
ETKLEPDISGRIYSPFYPSLLPPQCSCSWRFKTPNSKLGVALLFENYALKPEDIKGCDSG
WWRVNEVIFCGMYVGHHTVFRIPDHSPQMEFRCSSPNSAQPFQASYYSYNISQPCQEGQF
LCTTGLCVEKSRLCDGLDDCQDESDEVFCPRPPITCSTKIPPHPLFVCNGEMDCSDGVDE
INCTKETSCSAIRYRCRSGSCILKKNAKCDDIPDCRDNSDEDDCACGLPSPLRKVDSTSG
LDRIVGGVNSHEGEWPWQVSLHFAGSLYCGASVLSSDWLVSAAHCFRKESLSDPRSWSAH
LGMLTQGSAKHVAEIQRIVVHEYYNAYTFDYDIALLQLKRPWPPSLWPLVQPVCLPPSSH
TVTDTHRCLVTGWGYRSEEDKVLPSVLQKAEVSIMSQTECKKSYSPITPRMLCAGLLSGE
RDACRGDSGGPLSCQASDGGRWFLIGIVSWGSGCGRPNLPGVYTRVTKFTSWIYSHIKEA
TVGISSLSLPLSIVSMSEVLLRVTSLGAKLDCAMWTLPQSKTCEVYCVSAHGHSGCPATQ
RDGELKQSTGSLDPSLPKSEGPVGQKTESQAASSCCSWRRLVLGLLPFLPFTVAITLTLN
YLTSPSCSVFFLGSSVEFPNLTFSLELTDPASPQFRLQAQALDHYFSKLYDSTPWSSYYL
RSGITAFSEGEEGLGVFYWSKFSAPHNVALEIQSSSPERLQRRLPGTNKVVRYSRNEQHY
YMEQEDDTLPLLDLDSDDSDSEDRIDKMKNPNSIQGGKWQLGFQAISFDLYAKYGNNRTL
SLVSPKKPYYQWRLRVPSGHVVRLVVLTLQGATPGSCTAHKLSAYDFLLPLQNKIIARWC
GLPVSGSSPVMKLTSSGNVMLVTFSFSRQKDGAIFKAYFQAIPKAGCGGSISSWNGSISS
PYYPSFYPPNIDCTWTLRVPVPGYLISMTIVTLDIQDSPSSDGCEKDWLDIAGVKLCNPL
SESSRKRVYSSPLSIHFHSDESLTNQGFYLLYRAFSPEGTCPRQFRCGDGRCIPLRKVCD
GVKDCSDGRDEAKCSSCRPGEVLCGNGQCKPQSSQCVGQSSCADSSEEGSCGVKCFHVCP
NKVCLPKSSVCDGVIDCKDRSDELNCTRAYLKSCSVASYKCANGKCVSKVNPECDGVKDC
FDGSDELRCGCGTRPKKRTKIVGGSDAVLGSWPWQVSLQMERYGHVCGATLVSSRWLISA
AHCFQDSDAIKYSDARAWRAYLGMRVMTRGNHGGATRLIRRILLHPQYDQFTSDYDIALL
ELSAPVFFNDLVQPVCVPASSHTFTTGTSCFVTGWGVLMEDGELASRLQEASVKIINRKV
CNKLYDDAVTPRMLCAGNLQGGVDACQGDSGGPLVCLERGRRWFLAGIVSWGEGCARQNR
PGVYTQVVKFTDWIRQQTKGQV
NT seq 5289 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgaaggggaaggagacggagcagacaaaagggaacgatggtgacagaccacac
caggactcggcgagtattgcggatgtgtccgtggaagtggccactgtggaccacaccctc
cggaagctgtgcaggatgtacaggaagtcgaggcggaagcccaaaggactcaagaggctg
tgggcgtacctgctgaacgtgcctcacatcacaacgatcaccgcggccgtgctgtttgtg
gtggtggtgatcatatggtcactgctctgggtctttatcttccgcagggaaagctacagc
ggagcgtattttgccgggatgttccgtgttgccaacgtggagttcatcccagagtaccgc
caggcggagtcccatgagtttgtctctatggcaaccaaaattcaacaagtggtgagctct
gtgtacaggacgtcctcagtggccagactctacaagcaagtggtcatttcagacctcagt
aacaacaacaagggcggagtgttggtgcatttctggatggtgttcatcgtcccccagatg
aagaccacagcgatgcgagaagatttcatagaggccattctcagagactcaatcaacacc
aacctgaagaaccggtcttctgtgggcttcctgcatgaacttccagttgacatggactcc
atcctcatcaacggagttcagcgttcagattactcatcaaacacagcagactcgcagtgc
gttgataagctgtacgccaacctccccggagccagcgtcccgctaaacgtctactcatcg
tggggaggcgtgaactgccacgtgaagctgactgcagtgcccagctctctgatccgcctg
accgtcacctcgttcctcattgagcccactgactgtgtgaacgacgccctgaccgtgtac
gacgctctgctgcccatgagagggcgcattctgcacaggctgtgtgagccggtgtccagc
tccttctccatcgtctctacctccaacgtcatgctgctgtccttcaggatgaccagtgac
agcaagagctttaacggacactttgaagccgttgctgagcaaatttgtatgtctcaaatt
gagaccaagttggagcctgatatcagtggtcgaatctacagcccgttctacccgagcctg
ctgcctccacagtgttcctgtagctggaggtttaagactccaaactctaaattaggcgta
gctctgctgttcgagaactacgcgttgaaacctgaggacataaaaggctgcgatagtggc
tggtggagggtcaacgaagtcatattctgcggcatgtacgtaggacaccacaccgtgttt
cggatccctgaccacagtccacagatggagtttcgctgcagctcacccaactctgctcaa
cctttccaggcttcatactacagttacaacatcagccagccgtgtcaagagggccagttc
ttgtgcaccactggactctgcgtggagaagagtcgactctgcgacggcctggatgactgc
caggatgagagcgatgaggtcttctgcccgaggcccccaataacctgcagcaccaaaatc
cctccacatcctttgtttgtatgtaatggagagatggactgctctgatggagtagatgag
ataaactgcacaaaggaaacgagctgctcggcgatcagataccggtgcaggagcggatcc
tgcatcctgaagaaaaatgcaaaatgtgacgacatccccgactgtcgggacaacagcgac
gaggacgactgtgcctgtggcctcccctccccgctgaggaaggtggactctacgtcaggc
ctcgataggattgtgggcggggttaactcacacgagggggagtggccttggcaggtcagc
cttcactttgcaggcagcttgtactgcggcgcttctgtcctctcctctgattggctcgtc
tcagctgcccactgcttcagaaaagaaagcctctctgaccctcgctcctggagtgcccac
ctcggcatgctgacgcagggcagtgccaaacacgttgcagagatccagaggatcgtggtg
catgagtactacaatgcgtacacttttgactatgacatcgcccttctgcagctgaagagg
ccctggcctccctccctctggccgctggtccagcctgtgtgcctgcccccctcatcccac
acagtcacagacacacaccgctgcttggtgaccgggtggggataccgatctgaggaagat
aaggtgctgccctctgtgctccaaaaggcagaggtgtccataatgagtcagaccgagtgc
aaaaagagctacagtccaatcaccccgcgaatgctgtgcgccggcctcctctccggagag
agggacgcctgcaggggggattcgggaggtcctctgtcctgccaggcctcagacgggggt
cgctggttcctcatagggattgtgagctgggggtccggctgcggcagaccaaacctgcct
ggggtctacaccagggtcaccaagttcacctcctggatctacagccatatcaaggaagca
acagtggggatttcctctctttccctccctctctccatcgtttctatgtccgaggtattg
ttgcgagtcacctctcttggagctaaactggactgtgctatgtggactctgccccaaagc
aaaacttgtgaggtgtactgtgtctccgcacacggacactctggctgtccagctacacag
agagatggagagttaaagcagtccaccggctcacttgacccctccttgccaaagtctgag
ggtccggtgggacagaagacagagagccaggcagcgtcatcgtgctgctcctggaggagg
cttgtgttaggcctcctaccatttttacctttcactgttgccattacactgactctcaac
tatttaacatctccgtcttgctcggtgttcttcctgggcagcagcgtagagttcccaaac
ctgaccttctcattagagctgaccgaccccgcctcccctcagttccgcctgcaggctcag
gctttggaccattatttctcaaaactctacgactcgaccccgtggagttcttactacctg
cgctcaggaatcactgccttcagtgaaggagaggaggggctcggtgttttctactggagt
aaattttcagccccccacaatgtggccctggaaatccagagctccagcccagagaggctg
cagcggaggctccccggcaccaacaaggtggtgcggtacagccgcaacgagcagcactac
tacatggagcaggaggatgacacgctccccctactggatttggactctgatgattctgat
tcagaagacagaatagacaaaatgaaaaacccaaatagcatccagggaggaaaatggcag
cttgggtttcaagcaatatcttttgatctctacgctaaatacgggaacaaccgaaccttg
agtcttgtgagtcccaagaagccatactaccagtggcgcctgcgcgtgccctcgggtcac
gttgtgcgtctggttgtcctgacgcttcagggtgccacgcctggaagctgcacagcccac
aagctctctgcctatgacttcctgcttcctttgcagaacaagatcattgccagatggtgc
gggctgccggtgtcaggctcatctccggtcatgaagctgacctcctcggggaatgtgatg
ttggtcaccttctcctttagcaggcagaaagatggagcaatcttcaaagcctactttcaa
gccatcccgaaagcaggctgtggaggctcgatttcttcatggaacggctccatttcctca
ccttactacccctccttctatcctcctaacatagactgcacatggactctacgggtgcct
gtgccaggatatctgatttcgatgacaatcgtgactttggacattcaagattccccgtcg
tctgacggctgtgagaaggactggctggacattgcaggggtcaagctgtgtaatcccctg
tcagagagcagcagaaagagagtgtactcctctcctctctccatccacttccactctgat
gaatctctcaccaaccagggattctacttgctgtaccgagctttctctccagagggcacg
tgccctcgccagtttcgctgtggagacggacgctgtatccctctgaggaaggtctgtgac
ggagtgaaggactgctcagatggacgggatgaagctaaatgctcatcctgcaggcctggg
gaagtgctctgtgggaacggtcagtgcaaacctcagagcagccagtgtgttggtcagagc
agctgtgcagacagcagtgaggaaggcagctgtggagttaaatgcttccacgtttgtccc
aacaaggtgtgtttaccaaagtcatctgtgtgtgatggtgtgatcgactgcaaagaccgc
agtgatgaactgaactgcaccagagcatatctcaagagttgctccgtggcgtcctacaaa
tgtgccaatggaaaatgtgtcagcaaggtcaaccctgagtgtgacggagttaaagactgc
ttcgacggctctgacgaactgcgctgtggatgtggcaccaggcctaagaagcggactaag
atagtcggggggtctgacgctgtgttggggtcgtggccctggcaggtcagcctacagatg
gagcgctatggccacgtctgtggagccacgctggtttccagtcgctggctcatctctgca
gcgcactgcttccaagactctgacgccattaagtactctgacgctcgtgcgtggcgggct
tacctcggcatgcgtgtgatgaccaggggaaaccacggaggagcgaccagactcatccgt
cggatcctgctccacccccagtacgaccagttcacgtctgactacgacatcgcccttctc
gagctcagcgctccagttttctttaatgacttggtgcagccggtgtgtgttcctgcttcc
tcacacaccttcaccaccgggacgagctgctttgtcacgggatggggcgttctcatggag
gacggtgaactggcgtctcgtttacaagaagcttcagtgaaaattattaatagaaaagtc
tgcaacaagttgtacgatgatgctgttactcccaggatgctgtgtgcaggaaacctgcag
ggaggtgtggacgcctgccagggggattcaggcggtccgctggtgtgtctggagcgagga
agacggtggttcttggcagggattgtcagctggggcgaaggctgcgcgaggcagaaccgc
cccggcgtctatacccaggtggtcaaattcaccgactggatccgccagcagaccaaaggt
caggtctga

DBGET integrated database retrieval system