KEGG   Poecilia reticulata (guppy): 103457481Help
Entry
103457481         CDS       T05149                                 

Gene name
sod2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04068  FoxO signaling pathway
pret04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pret00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    103457481 (sod2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    103457481 (sod2)
Enzymes [BR:pret01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103457481 (sod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 103457481
NCBI-ProteinID: XP_008395853
LinkDB All DBs
Position
LG21
AA seq 225 aa AA seqDB search
MLCRAGEIRRCAVSLSQSICKIAASRQKHTLPDLTYDYGALEPHINAEIMQLHHSKHHAT
YVNNLNVTEEKYEEALAKGDVTAQVALQPALKFNGGGHINHTIFWTNLSPNGGGEPQGEL
MEAIKRDFGSFQKMKEKMAAVTVAVQGSGWGWLGYEKETGRLRIAACANQDPLQGTTGLI
PLLGIDVWEHAYYLQYKNVRPDYVKAIWNVINWENVHERLQIAKK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgctttgcagagctggagaaatacgcagatgtgctgtcagcctcagccaaagcatttgt
aagatagctgcatctaggcagaagcacacacttcctgacctgacatacgactatggagca
ctggagcctcacatcaatgctgagataatgcagcttcaccacagcaagcatcatgccaca
tatgttaacaaccttaatgttacggaggagaaatatgaggaggctctcgcaaagggagat
gtgactgcacaagttgcccttcagcctgctttaaagtttaacggaggcggccacattaac
cataccatcttttggacgaatctctcgccaaatggtggcggtgaaccccaaggggagctg
atggaggccatcaaacgggactttggctccttccagaagatgaaagagaagatggcagct
gtaacggtagctgttcagggctcaggctggggatggctcggttacgaaaaggagaccgga
cgacttcgcattgctgcttgtgctaaccaggatccactgcagggcactacaggtctcatc
cctctccttggcattgacgtatgggagcatgcctactatctccagtacaagaatgtgcgc
cctgactatgtgaaggctatctggaatgtaatcaactgggagaacgtgcacgaacgtcta
cagattgccaaaaagtag

DBGET integrated database retrieval system