KEGG   Poecilia reticulata (guppy): 103460097Help
Entry
103460097         CDS       T05149                                 

Gene name
kmt5b
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pret00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103460097 (kmt5b)
Enzymes [BR:pret01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103460097 (kmt5b)
Chromosome and associated proteins [BR:pret03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103460097 (kmt5b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET RNA_pol_3_Rpc31 DUF3970
Motif
Other DBs
NCBI-GeneID: 103460097
NCBI-ProteinID: XP_008400316
LinkDB All DBs
Position
Unknown
AA seq 834 aa AA seqDB search
MKWLGESKNMVLNGRRHGSKLTSSEQPVSQTRSQQPQRTSLRHSRSHPRSRRCSRRCNGA
SLEAERRYVPSSGMTAKELCENDDLTTSLILDPYLGFQTHKMNTRFRPIKGRQEELKEII
ERFKKHDNMEKAYKALTTGDWCRNLFLHKSKAQEKLFKQHVFVYLRIFTADSGFEILPCN
RYSSEQNGAKIVATKEWKRNDKIEFLVGCIAELSESEENMLLRHGENDFSVMYSTRKNCA
QLWLGPAAFINHDCRPNCKFVSTGRDTACVKVLRDIEPGEEISCYYGDGFFGESNEFCEC
YTCERRGTGAFKSKAGLPVPEVPVINSKYGLRETDKRLNRLKKLGEGNRSSDSHSVGSHT
DVDSQEMPKTHQSARTRTSSSSSSSPGLKYRTRTPSRQTVSRAVSTSCSKPAPGNSSREP
KRLRSQSKPPSKVRLRSRRRAAAARADAAPLGLRDSKVLPCKSVVTVKKEKDGPEVAPLG
PRGCLTRHAAKENGGLPDGGRGSAYRTRRSTRTLKAPEPMPGAKLEPGAMDGLSPVPGGV
VIKTEPADMDEYLQHGGGVTQPSVLGSGYGRKRPSRLRTERTIKCEGSDCEPFAAGRDGG
NVLLSFADRHRDYNGVANGGKSLRRDKSKSGCRSQDKAKKKRRITRYDAQLILENSGGIP
KLTLRRRRDSSSSKTADGADAVASSTLSPTSSSKISIKFSKEHDKDKAGSYIAKLNNGFA
PVVHGNATKLKIQLRKEDDARRLQANGEAAGGAHRTQKVLADPSSEEDDDDDDDEEEEEE
EEEEEDDDYFHNDFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggctgggcgaatccaagaacatggtattaaatggcagacgccacgggagcaag
ttgaccagcagcgaacaaccggtgagccagactcgctcccagcagccrcagcggacgtcg
ctgcgccacagcaggagccacccgcgcagccgcagatgcagccgcaggtgtaatggcgcc
agcctggaggcggagcggcgctacgtgccgtcgtcagggatgaccgccaaggagctgtgt
gagaacgacgacctgaccaccagcctcatcctggacccctacctgggcttccagacacac
aagatgaacaccagattccggccaatcaaaggacggcaggaggagctgaaggaaatcatc
gagcgctttaagaaacacgacaacatggagaaggcctacaaggcgctgacgacgggagac
tggtgccggaacctgttcctgcacaagtccaaggctcaggagaagctcttcaagcagcac
gtgttcgtctacctgcggatattcacggcagacagcggcttcgaaattctgccctgtaat
cgctattcatcggagcagaacggagccaaaatcgtggctacgaaggaatggaagaggaac
gataagatcgagttcctggtgggctgcatcgccgagctgtcggagagcgaggagaacatg
ctgctgcgccacggagagaacgacttcagcgtcatgtactccaccaggaagaactgcgcc
cagctgtggctcggcccggccgccttcatcaaccacgactgccggccgaactgtaagttt
gtgtcgacgggccgagacacggcctgcgtcaaggtcctgagggacatcgagcccggggag
gagatctcctgttactatggagacggcttctttggggaaagcaatgagttttgtgaatgt
tatacgtgtgaaagacggggaaccggtgctttcaaatccaaagctgggctgccggttccg
gaggttccggtcatcaacagcaagtacgggctgcgggagacggacaagcggctcaaccgg
ctgaagaaactcggagaagggaacaggagctcggacagccactctgtgggatcccacacc
gacgtcgactctcaggaaatgccaaaaacacatcaatctgccagaaccagaacttcatct
tcatcgtcttcatcgccgggcctgaagtaccggacccggaccccgagcagacagactgtg
tcccgagccgtctctacctcatgttccaaaccggctccaggaaacagcagcagggaacca
aagagacttcgctcccagtccaagcctcccagcaaggtgcggctgcgcagccgcaggcgg
gcggcggcggcccgcgcagacgccgccccgctgggccttagggactccaaggtgttgccg
tgtaagagcgtcgtcaccgtgaagaaggagaaggacggtccggaggtggcacctcttggc
ccgaggggctgcctgacccgacatgccgccaaagagaacggcggccttcccgacggtggc
cgcggctccgcctacaggactcgcaggtccacgcggaccctgaaggccccggagcccatg
ccaggcgccaagctggagcccggcgccatggacgggctcagcccggtaccgggcggcgtg
gtcattaaaacggagccggcggacatggacgaatacctgcagcacggcggcggcgtgacg
cagccgtcggtgctaggcagcggctacggccggaagcgaccgtcccgactccggactgag
cggaccatcaaatgcgaaggctccgactgcgagccgtttgctgcggggcgggatggcggg
aacgtgctgctgagcttcgccgacagacaccgggactacaacggcgtggccaacggcggc
aaatccctccgccgcgataagagcaagagcggctgccgctcgcaggacaaggccaagaag
aagcggcgcatcacgcgctacgacgcgcagctaatcctagagaacagcggcggcattccg
aagctgacgctccgccggcggagggacagcagcagcagcaagacggctgacggcgccgac
gccgtggcctcatccacgctcagccccacctcctccagcaagatcagcatcaagttcagc
aaggagcacgacaaggacaaggccggctcctacatcgccaagctcaataacggctttgcg
cccgtcgtccacggcaacgccaccaagctgaagatccagctgaggaaggaggacgacgcc
cggcggctccaggccaacggggaagcggccggcggcgcccatcgcacccagaaagtcctg
gccgacccttcctctgaagaggacgacgacgacgacgacgatgaggaggaagaggaagag
gaggaggaggaggaagacgacgactacttccacaacgacttcgaggacgacttcattcca
cttcctccggcgaagcgtctgcggttgatcgtggggaaagactccatcgacatcgatatc
tcctccaggaggagggaggatcagtctctgcggctcaacgcctga

DBGET integrated database retrieval system