KEGG   Poecilia reticulata (guppy): 103467053Help
Entry
103467053         CDS       T05149                                 

Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
pret  Poecilia reticulata (guppy)
Brite
Enzymes [BR:pret01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103467053
Chromosome and associated proteins [BR:pret03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103467053
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 103467053
NCBI-ProteinID: XP_008411328
LinkDB All DBs
Position
LG7
AA seq 912 aa AA seqDB search
MDLRVGERGTPLHQPLLLTPFSPQGRSAFSQQQQQLHQQIRSCGLDCLLYYAVILPSVCC
FVCARVCLCRCCRSAGAVASSAVKQKLQEVILKKQKQAALERTNSNVLNAHPVPYRKLGP
DPNVPAQPLVSSPSQPPSDGLEGTPLRRAASEPNLKVKHKLKNHLKTRKSPLTRKESAPP
TIKHRASDTLDSSPSSSSTPVSGCSSPNDSLPNENGLLPSAGGPLHEAQKLLLRDGTLSN
FTIQNPSTLPTITLGLPVSPRVSACLIHVAFIWIISYFYTLWECLVLKGSVFMSLVFPLS
TCLSAVPGLDPVPLQLASQLDRLSPGGVQAHKPLSRTRSEPLPQSPRALHNHLLQQQHNA
QLLERLKQQTHLGKLMSKSSEKPRLHQIPSEDMDSEDGGGVSPTETSYQSRVRAESLREV
EPTGSKAHEEQINLQHALILNQSLLYEQQKQLQQMHQQMETLAVPVFRGGGPACVPGGHR
VLSRTRSLPASTSLTPPENTLSLTAQDTVSKPRFTTGLVYDSQMLKHQCTCGDNSSHPEH
AGRIQSIWSRLQERGLRGQCESIRGRKANLEELQSVHTERHVLLYGTNPLNRLKLDNRKL
AGILSQRMFVMLPCGGVGVDNDTIWNESHTSTASRMAAGSVVELSFRVAKGELKNGFAVV
RPPGHHADPSNPMGFCYFNSVAIAAKQLQQKLSVSKILIVDWDVHHGNGTQEVFYSDPSV
LYISLHRYDDANFFPGSGSPTEVGSGAGEGFNVNIAWTGGLEPPMGDAEYLAAFRSVVMP
IAQEFSPDVVLVSAGFDAAEGNPAPLGGYKVSAKCFGFLTRQLMSLAGGRLILALEGGHD
LTAICDASEACVSELLGMQDAMPEDVLLQKPNANAMRSLQTVIEIQSEQQQHFNLSTLCL
FLALAINSCPLV
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atggacctcagggtgggagagcgggggaccccgctgcaccagccactgctcctcacaccc
ttctccccacaaggccgcagcgccttctcccagcagcagcagcagttgcatcagcaaatc
aggtcatgtggattggactgcttactttattatgctgtaattcttccatctgtgtgctgt
tttgtgtgtgcgcgtgtgtgtttgtgtcgctgttgtcgatctgcaggcgctgtggcgagt
tcagcggtgaaacagaaactccaggaggtgattctcaagaagcagaaacaggcggcgctt
gaaagaacaaactcaaatgtcttgaatgcacatcctgtaccctacagaaagcttggccca
gaccccaacgtccccgcccagcctctagtctcatctccatcacagcctccatctgacggc
ctggaggggacgccgctgcgcagagcagcatcagagcccaacctgaaggtgaagcacaag
ctgaagaaccacctgaaaacacgaaagagtccgctcacccgcaaggaaagcgccccgcct
accatcaagcaccgagcatcagacacgctggactcttcccccagcagcagcagcactccg
gtctctggctgtagttctcctaatgacagtctgcccaacgagaatggactgctgccctct
gcaggcgggcccctgcatgaggctcagaagttgctgctcagagatgggaccttgtctaac
ttcaccattcagaatccatccactctgcccaccatcacactgggactgccagtcagcccc
agggtaagtgcatgtttgattcatgtagcctttatttggattatttcctacttttatacc
ctctgggagtgtttggtgctgaaaggctctgtgtttatgtctttagtgtttcctctctcc
acttgcctctcagcagtgccgggcctcgaccccgtccctttgcagttggcatcacagtta
gaccgcctgtctccagggggcgttcaggcccacaagccactgagcagaacccgttcggag
ccccttccccagagcccgcgggccctccacaaccacctcctccagcagcagcacaatgcg
cagctgctggagagactcaagcagcagacgcacctgggaaagctgatgtccaagtccagc
gagaagcccagactgcatcagatcccatctgaggatatggattctgaggatggcggtgga
gtttcacccacggagaccagctaccagagcagagtgcgggcggagtcactgagggaggtg
gagccaaccggttccaaagcacacgaagagcaaatcaacctacagcatgcgctcatactc
aaccagtcgttgctatatgaacagcagaagcagctgcagcagatgcatcagcagatggaa
accctggctgtgcctgtgttccgcggcggcgggccggcctgcgtgcctggcggccatcgg
gtgttgtcgcgtacgcgctcgttgccggcctccacctcgctcactccgcctgagaacacg
ctgagtctgacggcgcaggacactgtcagcaaaccccgcttcaccaccgggctggtttat
gactctcagatgctaaaacaccaatgcacatgtggagacaacagcagtcacccagagcat
gctgggagaatacagagcatctggtcacgattgcaagagagaggcctgagagggcagtgt
gagagtatccgcggtcggaaggccaacctggaggagctgcagtcggtccacacggagcgc
cacgtgttgctttacggcacaaaccccctcaacaggctgaaactggacaaccgtaaactg
gctggaatcctctcgcaaaggatgtttgtcatgttgccatgcggcggagtcggggtggac
aatgacaccatctggaacgagtcgcatacttctacggcgtcacgcatggcggcgggcagc
gttgttgagctgtcattcagggtagccaaaggagagctcaagaatggctttgctgtggta
agacctccaggacatcacgccgacccctccaacccaatgggtttctgttattttaactct
gttgccatagctgccaagcagctccagcagaagctcagtgtcagcaagatcctcatcgtc
gactgggatgttcaccatggtaacggcacccaggaggtgttctacagcgaccccagtgtt
ctgtacatttcacttcatcgctacgatgatgcaaacttcttccctggcagcggttcacca
actgaggttggttctggagctggtgagggcttcaacgtgaacatagcctggaccggaggc
ttggagccgcctatgggagatgctgagtaccttgctgcattcaggtctgtggtgatgccc
attgcccaggagttctctccagatgtggttttggtgtcggccgggttcgacgcagctgag
gggaaccctgctcctctgggcgggtacaaagtctctgccaagtgcttcggcttcytgacc
cgccagctcatgtccctcgctggaggccgtctgattctggcccttgagggaggtcatgac
ctcacagccatctgtgacgcatctgaagcttgcgttagtgaactactgggtatgcaggac
gcaatgccagaggatgttctgctccaaaaacccaacgccaacgcaatgcgctccctccag
actgtgatagaaatacaaagtgagcagcagcaacactttaacttatccactctctgcctt
tttcttgcattagcaattaacagctgccccttggtttaa

DBGET integrated database retrieval system