KEGG   Poecilia reticulata (guppy): 103469906Help
Entry
103469906         CDS       T05149                                 

Definition
(RefSeq) prostaglandin G/H synthase 1-like
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00590  Arachidonic acid metabolism
pret01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pret00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    103469906
Enzymes [BR:pret01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103469906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 103469906
NCBI-ProteinID: XP_008416181
LinkDB All DBs
Position
LG9
AA seq 593 aa AA seqDB search
MKGFSLFSILAVLLLMKSSSGAAESSAVNPCCYYPCQNRGVCVRFGTESYSCDCTRTGFH
GKNCTTPEFWTRIYLMLKPGPGVAHFLLTHYQWFWTIVNNSFLRDTFMRIVLTVRNELIP
SPPTYNTKYGYISWESYNNVSYYTRLLPPVPEDCPLPMGTNGKPVLPDPKELCEKYFKRR
EFRPDPQGTNLMFAFMAQHFTHQFFKKSHKAPVGFTKALGHGVDASNIYGEELERQHQLR
LHKDGKLKYQLINGEMYPPPVSEVPVDMVYPESFPAEQQLAIGQEVFGLIPGLTMYATIW
LREHNRVCDILKGEHPTWDDEQLFQTTRLIIIGEIINIIIEEYVQHLSGYHLKLKYDPSL
LFGVRFQYTNRIALEFSHLYHWHPLMPDSFLIDGEEIPYSQFLYNTSILTRYGVEKLVDA
FSRQSAGQIGGGRNIHQAVLRVPEILMRDSRAARLQPFNQYRKRFNLKPYSSFYELTGDE
ETAQGLEELYGDIDALEFYPGLMMEKARPNSIFGESMVEMGAPFSLKGLLGNPINSPEYW
KPSTFGGETGFNIIKTSTLKKLVCLNTKWCPYVDFHVPRNEEELKPRNPSTEL
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggtttagcttgttttccatcttggcggttctgctgctgatgaaatcatcctca
ggtgctgctgagtcaagtgcagtgaatccctgttgctactacccttgtcagaacagaggt
gtgtgtgtgcgattcggtacagaaagctacagctgtgactgcacccgaacaggtttccac
ggaaaaaactgcaccactccggagttctggaccagaatctatctgatgctgaagcccggt
cctggagtggctcatttccttctgacccattaccagtggttctggaccatcgtcaacaac
tctttcctgcgagataccttcatgagaatcgtgctgactgtcagaaatgaacttattccc
agtccgccaacttacaacacgaagtacgggtacatcagctgggagtcgtacaacaatgtc
tcttactacacccgcctcctccctcctgtacctgaagattgccctttgccaatgggaacc
aacggtaaacccgttcttcctgaccccaaagagttatgtgagaaatattttaaaaggcgg
gaattcaggccagatcctcagggaaccaatctgatgtttgctttcatggctcaacacttc
acacaccagttcttcaagaaaagtcacaaagctcccgtaggattcaccaaggctttgggg
catggggtagatgcaagcaacatatatggagaagagcttgaaaggcagcatcagcttcgg
cttcataaagatggaaagctaaaatatcagctgatcaacggggagatgtaccctcccccg
gtgtctgaggtcccagtggacatggtgtaccctgaaagtttccccgctgagcagcagctc
gccatcggacaggaagtgttcggactcatcccaggcctcaccatgtacgccaccatctgg
ctgagggagcacaaccgggtgtgtgacatcctgaagggcgaacatccgacctgggatgat
gagcagcttttccagaccaccagactcatcattattggtgagatcatcaacattataata
gaggagtacgtgcagcacctgagcggctaccacctgaagctgaagtacgacccctccctg
ctcttcggtgtgcgcttccagtacactaaccgcatcgccctggagttctcccacctctac
cactggcacccgctcatgccggacagcttcctcatcgacggagaagaaatcccgtactcc
cagtttctgtacaacacctccatcctgacgcgttacggcgtggagaagctggtggatgct
ttctctcggcagtctgcaggacagataggcggcggtcgcaacattcaccaagcggtgctc
cgagtcccagaaatattgatgagagattccagagctgcacgcctgcaacctttcaatcag
taccgaaaaaggttcaacttgaagccgtactcatccttttatgaattaactggtgatgaa
gaaacagctcaaggtttagaggagctctacggcgacattgatgccctggagttttatccc
ggcctcatgatggaaaaagctcgccccaactccatattcggagagagcatggtggagatg
ggagcccctttctccctgaaaggcctgcttgggaatcccatcaactctccggagtactgg
aagcccagcaccttcggaggcgagacgggcttcaacatcatcaaaacatcgactctgaaa
aaactggtctgtctgaacaccaagtggtgtccgtacgtggacttccatgtcccgcgaaac
gaggaggagttgaagccgaggaacccgtccaccgaactttaa

DBGET integrated database retrieval system