KEGG   Poecilia reticulata (guppy): 103470212Help
Entry
103470212         CDS       T05149                                 

Definition
(RefSeq) hexokinase-1 isoform X1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
pret  Poecilia reticulata (guppy)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pret00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103470212
   00051 Fructose and mannose metabolism
    103470212
   00052 Galactose metabolism
    103470212
   00500 Starch and sucrose metabolism
    103470212
   00520 Amino sugar and nucleotide sugar metabolism
    103470212
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103470212
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    103470212
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103470212
Membrane trafficking [BR:pret04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103470212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
LG1
AA seq 923 aa AA seqDB search
MIAAQLLAYYFTELKDDQLKKIDKYLYSMRFSDETLKDIMGRFRRDMENGLGRDTNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVTQDKKQPVQMESQVYDTPDDIIH
GSGTQLFDHVAECLGDFMEKQKIKDKRLPVGFTFSFPCVQSKLDEAVLVTWTKKFKANGV
EGMDVVKLLNKAIKKRGDYQADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHMDLVEGDEGRMCINTEWGAFGDNGSLEDIRTEFDREIDRGSLNPGKQLFEKMASGM
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKIETKHVSAIEKTKEGLKKCMEILTRLG
VEPSDEDCLAVRHVCTIVSFRSANLISATLGAILSRLKDNKGVGRLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLTDQARQIQETLAEFRLS
KGQLLEVKKRMRMEIERGLKKDTHKEATVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPIEVMQGTGEELFDHIVHCISDFLDYMGMKSARLPLGF
TFSFPCHQTSLDAGILVTWTKGFKATDCEGEDVVELLREAIKRKELEDPEFELDVVAIVN
DTVGTMMTCAYEEPTCEVGLIAGTGSNACYMEELKNIEIVGGTEGRMCVNMEWGAFGDNG
CLDDIRTKYDQAVDENSLNEGKQRYEKMCSGMYLGEIVRQILIDLTKRGFLFRGQISETL
KTRGIFETKFLSQIESDRLALLQVRAILQQLGLDSTCDDSIIVKEVCGTVSRRAAQICGA
GMAAVVDKIRENRGLDHLDITVGVDGTLYKLHPHFSRIFHQTVKELAPKCDVNFLLSEDG
SGKGAALITAVGCRQRELDAQQH
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgatagcggctcagcttctggcctactacttcaccgagctgaaggatgatcagctcaag
aagattgataagtacctttactccatgcgtttctctgacgagacgctgaaggacatcatg
ggccgtttccgtagggacatggagaacggactcggccgagacacgaaccccacagcgacg
gtgaagatgctgcccacctttgttcggtccatccctgatggatcagaaaagggggacttc
atagctcttgatcttggtgggtcaaactttcggatcttgcgtgtcaaagtgacacaggac
aagaagcagccagttcagatggagagccaggtttacgacactcctgatgacatcatccat
gggagtgggacacagctctttgaccatgtagctgagtgcctgggtgattttatggagaaa
caaaaaattaaggataaaagactacctgtgggatttacgttctccttcccctgtgtccaa
tccaaactggatgaggccgtccttgtgacttggacaaagaaatttaaggctaatggtgta
gagggaatggatgttgtgaaacttctcaacaaggcaattaagaaacgaggggactatcaa
gcagacatcatggcagtggtgaacgacacagttggcaccatgatgacatgtggatttgac
gatcagcgttgtgaagtgggaatcattataggaacggggacaaacgcctgctacatggag
gaactgcgtcacatggatctggtagaaggcgacgaaggccgaatgtgcattaacaccgaa
tggggggcttttggggataacggctccttggaagacattcgtacagaatttgatcgagag
attgacagaggttccctcaacccaggaaagcaattgtttgagaagatggccagtggaatg
tacatgggagagctggttcgactcatcctagtgaagatggccaaggaggggctcctgttt
gagggaagaatcactcctgagcttctgaccaaaggaaagatcgaaacaaagcatgtttct
gccatagagaagactaaagaaggactgaagaaatgtatggagatcctgaccagacttggt
gtggaaccatcagatgaagattgcctggcagtcaggcatgtatgcaccattgtgtccttc
cgctctgcaaatctgatttctgcgactctgggagctatcctctcacgcctaaaggacaac
aaaggagttggacgccttcgcacgactgtgggaattgatggttctctctacaaaatgcac
cctcaatacgcccggcgcttgcacaagaccgtacgtcgtttggttccagactctgatgtc
cgcttcctgctgtctgaaagtgggagtggcaaaggtgccgccatggtgacagcagtggcc
taccgtttgaccgaccaggcgcgccagattcaggagactttggcagagttcaggctgagc
aaaggtcaactgctggaggtgaagaaacgcatgagaatggaaatcgaaagaggcctgaag
aaggacacccacaaggaggcgacagtcaaaatgctgcctacatttgttcggagtacacca
gatggaacagaaaatggagattttctagctttggaccttggaggaacaaacttccgtgtg
cttttggttaagattcgcagtgggaagaagcgcacagtagaaatgcataacaaaatctac
gccattcccatagaagtcatgcagggcacaggagaggagctttttgaccacattgtgcac
tgcatctccgacttcctggactacatgggaatgaaaagcgctcgactgccgctgggtttc
accttctccttcccctgtcaccagaccagtctggatgcaggtatcctggtaacctggaca
aaaggcttcaaggcaacagactgtgaaggtgaagatgttgtggagcttctccgagaagca
atcaaaagaaaagagcttgaagacccagagtttgagctggatgtggttgccatagtgaac
gacaccgtgggaacgatgatgacctgtgcgtatgaagagccaacatgtgaagtcggactg
attgccggcacaggaagtaatgcctgctacatggaggagctgaaaaacatcgaaatagtg
ggaggcaccgagggtcgaatgtgtgtcaacatggagtggggggcgtttggagacaacggc
tgtctggacgacatcaggacaaaatatgatcaggcagtggacgaaaactcactcaacgaa
ggcaaacagagatatgagaagatgtgcagtggaatgtatttgggagaaattgtgcggcag
attttgattgatctgacgaagcgtggcttcctcttccgaggacagatttcagagacactg
aagactcgcggcatctttgagaccaaattcctgtcacaaatagagagcgatcgtctggcg
ctgctgcaggtcagagcgatcctgcagcagctgggactcgacagcacctgtgacgacagt
attatcgttaaggaggtgtgtggaactgtgtcccgccgcgccgctcagatctgcggagcc
ggaatggccgccgtggtggacaagatccgtgagaaccgaggactggaccacttggacatc
accgtgggtgtggacggcacgctgtacaagctgcacccacacttctctcggatcttccac
cagacagtaaaagaactcgcccctaaatgtgacgttaacttcctgctgtcggaggacggc
agtggcaagggagctgctctcatcactgccgtgggctgccgccagagggagctagacgcc
cagcaacactga

DBGET integrated database retrieval system