KEGG   Poecilia reticulata (guppy): 103478611Help
Entry
103478611         CDS       T05149                                 

Gene name
setd2
Definition
(RefSeq) histone-lysine N-methyltransferase SETD2 isoform X1
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
pret  Poecilia reticulata (guppy)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pret00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103478611 (setd2)
Enzymes [BR:pret01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103478611 (setd2)
Chromosome [BR:pret03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103478611 (setd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
AA seq 2561 aa AA seqDB search
MDTLLKSELRQEGSAASVKVEGLSTSALIKSLSPRVMLSNHLLPKGTMRVNLEDQGRQKV
SFSFSQTKKPLQSSFFISANSDTTVTDPHNASSQSILDKVGKNTESKTEQKQAALAPSST
PEKRSQTSASPSTRLQKNLGKMHFKKQIISVSVTEESPKADTSEEVHVSESEVNSQSDTE
APAPPPENVINDGSPKYVATESSETKEDSNLKKSPSSSGKDGESSSCTDRDSNVYKRKTR
SQSDNAPPCSESDGDLTHASSSRKSEDSKSKTSSDSRVKEAKRSSSNSHAGEKEKNSSKR
TETQERSSSYSKSDRDSRMPSSRSSRSDKDRRRSRTRSRSRSRGSRTSSSHSRSERSRCD
RGSRSERSYYHESDRRSHRSSPRREKRRSRSRTERTRYSSDSEDDHRKTRTRTSGSSRSS
NYSSSHKASQSSSYSRSEKSSKSLESPHPSETDKRTQSSKSERTSKRSSDSDSQHRCSPD
LDSSSRKFSSHHRSDTSTKSSSSSTHSKSQSHDKNRKNSSGDSEGEHKTKPQSSEVNTSL
LENSKDSQEKTSRPGSKQVTPSRSSIKSPRHHSQSDDMFYSPAKAPSCETTAECSPQTER
EKSDSEPGEDAQGGQGDTEMVLSTEKTLQECLGKTEQVKPVLELEPENASATTSIENLKL
VDVTLENVCNVKASESELNLTPTVLNSVESENSVIGKVPKPSLDATETNDEIQQNTNLEI
VEPNDVLAAENQYDPQKSDLPCLEAESQLSEGQQSKDAAKKSTCTTRKSRWDIVGQDSCE
NDNSNRAVCAESNLSPKKVVSVKRIEFSNDGAQHDLDSKGSIQSRDAKHSNVEQDVSLVT
FKHEDQSEPSQASTSIDRCDFSCTTHKPYTDEPSHMNDQLSQIHLATLGNIQNIDACENK
LKESTHRNKSSKRTAADQDMLATPSDASDSDNSAYDSDCDNAIKQFHSVVVVPKHSSLTK
DGQASSCTPLRISEQPGTQSGKSNQVNAQQTQTTTTSFAESPHIAVLCQSQSNMIDSTSH
SEGSNAIGGQLFGADHTGAQRSATDSIPLLDHSRQCEQSLKHREISSQGEQVHLQYQPNT
LSDNINSKMSFSLGWDLSQPEQPTSTCQQPDSSYGPQLNTKATATDSKEPEQSIHSGTHQ
LPNMQTIKRPYLHTHHEHYQEPLSEIHPDSLTNDHDDYRAEKSSSHNKALNTPGSASSVQ
GPEISSNSRGPALPEPPREDNHRPHRSRGPPKKRRPEIESDSDNEAEAGPSGKRERQEDV
AVSKEVKAEVDRPSLTLRNFQDSGRWKDLAKIKKMPPYFDLIEENKYLTERKKSKSHRDI
KRMQCECPVLSREDRAKGVMACGEDCLNRLLMIECSSRCLNGAYCSNRRFQMKQHADFEV
ILTEDKGWGLRAARDLVPNTFVLEYCGEVLDHKGFKSRVKEYARNKNIHYYFMALKNNEI
IDATLKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTTAVAVGTELTFDYQFQRYGKE
AQKCFCGAPSCRGFLGGENRVSVRAAGGKMKKDRSRKNALTTVDEELEALLENGEGLYDE
KQVVSLCRLMVRVETMEQKLLCLKLIQDTQNPSCLKQFLDHHGLSLLWIFMVELSEAKGN
SANNNKLQLEIMKTLAVLPISTKNMLEESKVLTLIQRWAQIKTLPQQAEMDGYSSENTSR
AQTPLNTPDGSSAKMAPELDGDASKPAVYRRLKIISENSLDSALSDASKASDGKEDEEEE
EEAENLNADPPDGASLKEEHLSEVVEPTKESVEGFGKELPRQDESETSSNSQQQPQDVDM
KDEAELDSKIKETNEGPTNEAETPNVPCEEASTKNSESEKAPEKVESEGDLASVKMEEPE
SQSNQTVPADVPTEQLQETKDTRKEAAEEEASTEPQLGEPATEAPPNSETPEAPVHAEGT
AAQVEPSVIGTPSQDEEEGVSDVESERSQEPHLSVLDISGMAARLLESWKDLKEVYRIPK
KTQVEKEARDRSRDRDLALTPRTASGSREREREREKERERDRERDYDRDRDRDRDRERSR
DRDRDRDRDRTADKTPRNSERRRRRSPSPPPLPYERSSRRNEERFDTPSSKTQRGAGGKE
RNKLSTEERRKLFEQEVAQQEAQKQQQLQQQQQQQQQQQLQTLTYDPLVYASSPGFITYP
PGYPMQTFVDPTNPNAGKVLLPTPAVDPGLSYEQTSAPDLSLPSPSSTSQAAPVSNVSQH
ITTTNLTTANPQQYTQPAVAAQEGGVAVLSVSAPQAPQAQGQQSYATLWDPTTQQAVTVQ
TQPAQQYAAAPGPPQTAIYYQGQPCQTIYSIPTAYPQANAPVIQAYTEPTAGYLHGQPVY
PGHQQGVVVQQGGTVTTIVTSQTVQQEMIVPNNVIDLPPPSPPKPKTIVLPPNWKAARDP
EGKIYYYHIVTRQTQWDPPTWEGSSDNTSVDHESEMDLGTPTYDENPSKFSTKTAEADTS
SELAKKSKETFRKEMSQFIVQCLNPYRKPDCKSGRISNTEDFKHLARKLTHGVMNKELKA
CNNPEDLECNENVKHKTKEYIKKYMQRFGSVYRPKEDTDVY
NT seq 7686 nt NT seq  +upstreamnt  +downstreamnt
atggacactcttctgaagtcagagctcagacaggaaggaagtgctgcttctgtgaaggtg
gagggtctatccacgtcagctctgattaaaagcttgtctccccgagtcatgctgtccaat
catcttttaccaaaagggaccatgagggtcaacctggaagatcagggtcgtcagaaagtg
tccttcagcttctcgcagacaaaaaagccgctgcagagttcattcttcatatctgccaat
tctgatacgactgtcactgaccctcacaatgcctcatctcagtctatcttggacaaagtg
ggaaagaatacggaaagcaaaacggagcaaaagcaggcagccttggcgccgtcatctaca
ccggagaaacgttctcaaacgtcggcctcgccctcaactcgactccaaaaaaacttagga
aagatgcattttaagaagcaaattattagcgtttctgttactgaagagagtccgaaggct
gatacgtctgaggaggtgcacgtctctgaatcagaggtcaactctcagagtgacactgaa
gctccagctcccccgcctgagaacgtcattaatgacggctcccctaaatatgtagccact
gaatcctctgagacaaaagaagattctaacctcaagaaatcaccttcctcgtccggaaaa
gatggcgaaagttccagttgtactgatcgggattctaatgtgtacaaaaggaaaaccagg
tcacagtcagacaatgctcctccttgctctgaatctgacggtgacttgacccacgcgtct
tccagccgcaaatcagaagattcaaaaagcaaaacaagctctgacagccgggtcaaagag
gcaaaaaggtcttcctctaattcacatgcgggggaaaaggagaaaaattcctccaagcgc
acagagactcaagaacggtcttctagttactccaagtctgatcgtgattctaggatgcct
tcctctcgctcgtctcgctcggacaaggaccgcaggagatccaggactagatcacgttct
agatcaagaggctctcggacaagttcgtctcactccagatccgagaggtccaggtgtgac
agaggttctcgctcggagagatcgtactatcacgaatctgatcggcggtcccacaggagt
tctccacgcagggagaaaagacgttcccgctctcggactgaaagaactcggtacagttct
gactctgaggacgaccacagaaaaacgaggacgaggacgtccgggtccagcaggtcatct
aattattctagctcacataaagcatcacagtcatcttcctactcgaggtcagagaagtct
tcaaaatctttagagtctcctcacccctcagagactgacaaaaggacacagtcatcaaag
tctgaaaggacttcaaagcgttcctcagactcagattcccaacataggtgctctcctgat
ttggactccagttcccgcaaatttagcagtcatcacaggtctgacaccagtaccaaatca
tcttcttctagtacacatagcaagtcccaatcacatgacaagaacagaaaaaacagctcc
ggtgattcagagggagaacacaaaacaaaacctcagtcttctgaagtaaatacaagtttg
ttggagaacagtaaagactctcaagagaaaacaagtagaccaggatcaaagcaagtaact
ccctctaggtcctccataaaatcccctagacatcacagtcagtcagatgacatgttttat
agtcctgccaaagcgccatcatgtgaaaccacggcagaatgtagtcctcagacagaaaga
gaaaagtcagattcagaaccaggtgaggatgcacagggcggtcagggtgatacggagatg
gttttatctactgaaaagactttgcaagaatgtttaggaaagacggagcaagtaaaacca
gtacttgaactagaacctgaaaatgcctcagctacaacctcgatcgagaacctaaagctt
gtcgacgtcactctggaaaacgtgtgcaatgtgaaggccagcgagtcggagttgaactta
actccaactgttttaaattcagttgaaagcgaaaatagtgttatcggcaaagtgccaaaa
ccctctcttgatgctacagaaacaaatgatgagatccagcaaaacactaatttggagatt
gttgaaccaaatgacgttttggcagccgaaaatcaatatgacccacaaaaatctgatttg
ccctgtctagaagctgaaagtcagctttcggaaggacaacaaagtaaagatgccgccaaa
aagagtacctgcactaccagaaagtctcgctgggatattgtcgggcaagactcatgtgaa
aatgataattcaaacagggctgtttgtgcagaaagcaatctcagccctaaaaaagtggta
tccgtcaaaagaattgaattctctaatgacggtgctcaacatgacctggacagtaaaggt
agcattcagtccagagatgctaaacattccaacgtggagcaggatgtctctttagtgacc
tttaaacatgaagaccaaagtgagccttcgcaagcaagcaccagcattgaccgctgtgat
ttcagttgtactactcataaaccgtacacagatgagccttcacacatgaacgatcagtta
tcccagattcacttagccacgttaggaaacatccagaatattgatgcctgtgagaataaa
ttaaaggagagcacacacaggaataaatccagtaaaagaacagccgccgaccaggatatg
ctagcaacgcccagtgacgccagtgacagcgacaactccgcgtacgactcagattgcgac
aatgccataaagcagtttcactctgtggttgtagtccccaagcattcctccctgacaaaa
gatggacaagcctcttcatgtacccctttacgtatttcagaacagcccggcacccaatcg
ggaaaatctaaccaagttaacgcacaacaaacgcaaaccacgacaactagctttgctgag
tcgcctcatatcgccgtgctctgtcagtcccagagcaacatgattgatagcaccagtcac
tcagaaggttccaacgccatcggcggtcagcttttcggagccgatcataccggtgcccaa
cgaagtgcaacggattcaatccctttgcttgatcattccagacaatgtgagcaaagtttg
aagcatcgtgagataagcagtcaaggcgagcaggtgcacttgcagtaccaacccaacacc
ctctctgacaatatcaacagcaagatgagtttcagcttgggctgggatttatctcaacca
gagcagcctaccagcacatgccagcagcccgacagcagctacggaccacagttaaacact
aaagcaaccgcaacagattccaaggagccagagcaaagtattcactccggtacgcaccag
ttgccaaacatgcaaaccatcaaaagaccttacctccatacgcaccacgaacattatcag
gaacctttgagtgaaatccacccggactcgctcacgaatgaccacgatgactacagagcg
gaaaagtcatcgagtcataataaagcactaaacactccaggatcagcgagctcagtgcaa
ggtcctgaaattagcagcaacagcaggggccctgctttacctgagccacccagagaggat
aatcatagaccccacagaagtagaggaccgcccaagaaaaggcgtccggagattgagtca
gattcggacaacgaggcagaagctggaccgtctggaaaaagggagcgtcaagaagatgtt
gcagtttctaaagaagtaaaagccgaggtagaccgaccatcgctcactctacgcaacttt
caagatagcggcagatggaaagacttggccaagattaaaaagatgcccccttactttgac
ttaattgaggagaacaagtacctaactgagagaaagaaaagcaaatctcatcgagatatc
aagaggatgcaatgcgagtgtccagtgttgtcgcgagaggaccgcgcaaaaggagtgatg
gcgtgtggagaagactgtttaaaccgactccttatgattgaatgctcgtcacggtgcttg
aatggagcatattgctctaaccgtcgcttccagatgaagcagcacgcggacttcgaggtc
atcctcacagaagacaaaggctggggactgcgtgctgctagagacttggttccaaacaca
tttgtcctggagtactgtggcgaggtgttggaccacaaagggttcaaatcaagggtgaaa
gaatatgctcgcaacaagaacatccactactacttcatggcactaaagaataatgagatc
atcgatgcgacattgaagggtaactgctcgcgattcatgaaccacagctgtgagccaaac
tgcgagacccaaaagtggacagtcaacggccagctcagagtcgggttcttcaccaccacg
gccgtcgctgtgggaactgaactgacgtttgattaccagtttcagagatacgggaaagaa
gcgcagaaatgtttctgtggggcccccagctgcagaggcttcctcggtggtgagaacaga
gtcagcgttcgagcggctggagggaagatgaagaaagaccgcagccgaaagaacgctctc
accacggtggatgaggagctggaggcgttgctggagaatggagaaggcctgtatgacgag
aagcaggtggtgtctctgtgcagactgatggtccgagtggaaaccatggagcagaagctc
ctctgccttaagctcatacaagacacccagaacccatcgtgcctgaagcagttcttggat
catcacggcttgtccttgctgtggatctttatggtggagctctctgaagctaaaggcaac
agcgctaataacaacaaactgcagctagagatcatgaagaccctggctgtgctccccatc
tcgacgaagaacatgcttgaagagagcaaagtcctgaccctcatccagcggtgggctcag
attaaaaccctccctcagcaggctgagatggatggctactccagcgagaacacgtcccgg
gcccaaacccctctcaacactcccgacggctcctctgccaaaatggctccggagctggat
ggcgacgcatccaaacctgccgtttacaggcgcctcaagatcatcagcgagaacagcttg
gacagcgctctgtctgacgccagcaaggcatccgacgggaaggaggacgaagaggaggag
gaggaagctgaaaacctcaacgccgaccctcccgatggagcgagcttgaaggaagaacac
ctgagcgaagttgtggagccgacaaaagaatccgtggaggggtttgggaaagagttgcca
agacaggacgagtcggaaacgagctcaaacagtcagcagcagccccaggatgtggacatg
aaagatgaagcagagttagattcgaagattaaggagacaaacgagggtccgacaaatgaa
gctgagactccaaacgttccatgcgaggaggcgagtacaaaaaactcagaaagcgaaaaa
gcgccagaaaaggtggagtcagaaggagacctggcctctgttaaaatggaggagccagag
agtcagtccaaccaaacggttcctgcagatgttccgaccgaacagctgcaagagacgaag
gacacgcgaaaggaggcggcggaggaggaggcgagtaccgagccccagctcggcgaacct
gccacagaagctccgccgaactccgagaccccagaggctcctgtccatgccgaggggacg
gcagcccaggtggaaccgtcggtgataggaacgccgtctcaggacgaagaggaaggcgtg
tcggacgtggagagcgagaggagtcaggagccccacctcagtgttttggacatcagtggc
atggcagccagacttctggagagctggaaggacctgaaggaggtctacaggataccaaag
aagactcaagtggaaaaggaagcaagagatcgcagccgtgatcgtgacttggctttgacg
ccacgcaccgcctccggcagtcgggaacgggaaagagagcgagagaaggaaagggagcgc
gacagagagagagactacgacagagaccgagacagggatcgggaccgagagcggagccga
gaccgggaccgagatcgggaccgagaccgaaccgcagacaaaacccctcgcaactctgag
cgacggagaaggcgctcgccgtctccgccccccttaccgtacgagaggagcagccgccgc
aatgaagagcggtttgacacgccgagcagcaagacacagagaggagctggaggaaaggag
cgcaacaaactgtccacagaggagcgcagaaagctgtttgaacaggaagttgctcagcag
gaagctcagaagcaacagcaacttcaacagcagcagcagcaacaacagcagcagcagctc
cagactctgacttatgaccctctagtctatgcctccagccccggcttcatcacctaccct
cccgggtaccccatgcagaccttcgtggatcccaccaaccccaatgctggcaaagtcctc
ctgcccacccctgccgttgacccgggcctcagctacgaacagacctctgccccagacctc
agcctcccctctccttcctccacatcccaggccgctccggtctctaacgtctcccagcac
atcaccaccaccaacctcaccacagcgaacccacagcagtacactcagccagccgtggca
gcccaggagggaggggtggccgtgctttctgtgtcggcgccacaggcccctcaggcgcag
ggtcagcagagctatgccacgctgtgggaccccaccacccagcaggcggtgacggtgcag
acgcagccggcccagcagtacgctgcggctccggggccgccgcagacggccatctattac
cagggccagccgtgccagaccatctacagcatccccaccgcttaccctcaggccaacgct
ccggtcatacaggcgtacactgagcccacagccggctacctgcatggccagccggtgtat
ccgggtcatcagcagggcgtggtggtgcagcaaggaggcacagtcaccaccatcgtcaca
tcccaaactgtgcagcaggagatgattgtacccaacaatgtgatagacctgccccccccc
tctcccccgaaacccaaaacaatcgtcctacctcccaactggaaagcagcccgggaccct
gaaggcaagatctactactaccacattgtcacaaggcaaacgcagtgggacccccccacc
tgggaaggcagcagcgacaacacaagcgtggatcatgaatctgagatggacctgggaacc
ccgacctacgacgagaacccctctaagttctccacaaagacggccgaagcagacacttcc
agtgaattggctaaaaaaagtaaagagacgtttcgcaaagagatgtcccagttcattgtg
caatgcctgaatccttaccggaagccggactgcaaatctggacgcatcagcaacacggag
gattttaaacacctggctagaaagctaactcacggcgtcatgaacaaggagctgaaagcc
tgcaacaaccccgaggacctcgagtgcaatgagaatgtgaagcacaagactaaggagtac
atcaaaaagtacatgcagcggttcggctccgtgtacaggcccaaagaggacacggacgtg
tactga

DBGET integrated database retrieval system