KEGG   Poecilia reticulata (guppy): 103479496Help
Entry
103479496         CDS       T05149                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  
DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pret  Poecilia reticulata (guppy)
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:pret00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    103479496 (lig1)
   03410 Base excision repair
    103479496 (lig1)
   03420 Nucleotide excision repair
    103479496 (lig1)
   03430 Mismatch repair
    103479496 (lig1)
Enzymes [BR:pret01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103479496 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     103479496 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103479496 (lig1)
DNA replication proteins [BR:pret03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103479496 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103479496 (lig1)
DNA repair and recombination proteins [BR:pret03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103479496 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     103479496 (lig1)
   MMR (mismatch exicision repair)
    Other MMR factors
     103479496 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
LG17
AA seq 1002 aa AA seqDB search
MQRSIASFFQPRIKVKDSQKKTADEPVNKPIKSPLKVQNGVQEADSPIKKVAKRSRQILD
SDEDEAPLVKEQGDKGAPAKTEKTDDVFKAVPTPLSPTPAPSTPITLETPETSASSTSSG
SPSSPSSTSTSRIVKRKTARKMFPKRKLDESESRKGESEVAEEQGQQNKRPRLESGVSSA
ENTDEPMEEGAKEEKVEKPVAEANSPDEEVGNEKTEGEKAKKEEEQVEEKISDEKEKKAE
GAEKKNEAKEKTDDEKGASVAKDKVVEKDTKDTGSPKSQMGEKKQKEAKEQKDKELAKKT
PISSFFAPRKAAVKTEKPEKNEGEKKTSAERKSSDEEQKDAKGESTSGETDYNPSRPNYH
PVDHACWKQGQKVPYLAVARTFEKIEEDSGRLRNIETLSNLLRSVLLLSPDDLLCCVYLC
LNQLGPAYLGMELGIGETVLMKAVAQATGRHLDKIKAEAQEKGDLGLVAESSRSNQRTMF
QPASLTAGGVFKKLKEIASMSGNSAMNKKIDIIKGLFVACRFSEARYIVRSLAGKLRIGL
AEQSVLAALSQAVCLTPPGQGFPPAVIDAGKGMSAESRRAWIEEKNLILKQTYCEMPNYD
VIIPVLLKAGIDQLPKHCKLTPGVPLRPMLAHPTKGVGEVMKRFDEAAFTCEYKYDGERA
QIHILESGEVRIFSRNQEDNTSKYPDIISRLPKVKKDSVVSCVLDTEAVAWDREKKQIQP
FQVLTTRKRKDVDASEIKVQVCVYAFDLLYLNGESLVRQPLCRRRELLRESFTEVEGEFL
FARSIDSHDTDAIAEFLEQSVRDSCEGLMVKTLEKDATYEIAKRSHNWLKLKKDYLDGVG
DTVDLCVIGAYLGKGKRTGTYGGFLLACYDEDNEEFQSVCKIGTGFKDEDLEQHYKFLKE
HILAKPRPYYRVDQSAEPDVWLDAVQVWEVKCADLSLSPVYKAAMGMVDAEKGISLRFPR
FLRIRDDKKPEDATTGAQIADLYKKQQQIQNQGEKADPEDYY
NT seq 3009 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggagcatcgcatcgttttttcagcccaggatcaaggttaaagacagccagaag
aaaactgcagacgaaccagtgaacaaacccatcaaaagccccttgaaggtgcagaacggc
gtccaggaagcggattcgccgatcaagaaggtcgccaagcgcagccggcaaatactggac
agcgacgaagacgaggcgccgcttgtaaaagaacaaggcgacaaaggagctcccgctaaa
actgagaagacggacgatgtgttcaaggccgttcccaccccgttgtctccaacgccggcc
ccatccacacccataaccctggaaaccccggagacgtcggcctcctcgacgtcgtcaggg
tcgcccagttctcccagttccacctccacgtctagaattgtgaagcgcaaaactgcgagg
aagatgttccccaagaggaagctggatgagagcgagagtcggaaaggggagtccgaggtc
gcggaggagcagggtcagcaaaacaaacgaccccgcctggagagcggtgtcagcagtgca
gagaacaccgatgaacccatggaggagggagcaaaggaagaaaaggttgaaaagccagtg
gctgaggctaacagcccagacgaggaggtggggaacgagaaaacagaaggagagaaggcc
aagaaggaggaggagcaggtagaagaaaagatctctgatgagaaagaaaagaaagctgag
ggggcggaaaagaaaaatgaagcaaaggagaagacggatgatgagaaaggggcctctgtc
gccaaagacaaggtggttgaaaaggacacgaaagacacagggagcccaaaaagtcaaatg
ggagaaaaaaagcagaaagaggcgaaggagcagaaagataaggagctggccaagaaaacc
ccaatcagcagtttctttgctccccgaaaagcagcagttaagacagagaaaccagagaag
aacgaaggagagaaaaagacgagtgcagagaggaagagctccgatgaggaacagaaagac
gcaaaaggtgaatcaacctcaggagagacggactacaatccatccagaccaaactaccat
ccggtggaccacgcctgctggaaacaaggccaaaaagtgccgtacttggcagtggctcgc
acctttgagaaaattgaagaggactctggcaggttgagaaacatcgagacgctgtcgaac
ctgctccgctcggtgctgctgctctctccagacgacctgctgtgctgtgtgtacctgtgt
ctgaaccagctcggccccgcctaccttgggatggagcttggcatcggggagacggtgctg
atgaaagccgtcgctcaagcaaccgggcgacatttggacaaaattaaagcggaggcgcag
gagaaaggagatttgggcctggtggccgagagttcccgtagcaaccagcgcaccatgttc
cagccggccagtctgacagcaggaggcgtgtttaagaaattgaaggaaattgccagcatg
agtgggaactcggccatgaataagaaaatcgacatcatcaaaggcctctttgtggcgtgc
cgcttctccgaggcccgctacatagtcaggtctctggctgggaagctgaggattggcctt
gctgagcagagtgtcctcgccgcgctgagccaggccgtctgcttgaccccgcctggacaa
ggtttccctcctgctgtgattgatgcaggaaagggcatgagcgctgagagcaggcgggcc
tggatcgaagagaagaacctcattctgaaacaaacatactgcgaaatgccaaattatgac
gtcatcatcccagttttactgaaagcaggcatcgaccagctgcccaaacactgcaaactc
actccaggagtcccgctgaggcccatgttggctcaccccaccaagggtgtcggcgaggtg
atgaagaggtttgacgaggcggcgttcacctgcgagtacaaatatgacggagagcgtgca
cagattcacattctggagagcggcgaagttcggattttcagccgcaaccaggaagacaac
accagcaaatacccagatatcatctcccgcctccccaaggtgaagaaggactctgtagtg
tcttgtgttctggacacggaggcggtggcctgggatcgagagaagaaacagatccaaccc
ttccaagtcctcaccactcgtaagagaaaggatgtggacgcctccgagatcaaagtccaa
gtgtgcgtgtatgcctttgacctcctctatctcaacggagagtccctggtgcgacagccg
ctgtgtcggcgtcgggagctgctgagagagagcttcacagaggtggagggagagtttctg
ttcgcccgttccatcgactctcacgacactgacgccatcgcagagttcctggagcagtcc
gtccgagactcctgcgagggcctgatggtgaagactctggagaaggacgcgacctatgag
attgccaagcgttctcacaattggctcaagttaaagaaggactacctggacggtgtgggc
gacacggtggacctctgcgtgatcggtgcctacctgggaaagggaaaacgaacaggcacc
tacggtggcttcctgctggcctgctacgatgaagacaatgaggagtttcagtcagtctgc
aagatcgggacaggctttaaggatgaagatctggagcagcattacaagtttttaaaggag
cacatcctggccaaaccccgcccctactaccgcgtggaccaatcagccgagcccgacgtg
tggctggacgctgtgcaggtttgggaggtgaagtgcgccgacctctcgctgtcacccgtc
tacaaggctgccatgggaatggtggatgcagagaaaggcatttctctgcggttccctcgc
ttccttcgcatcagagacgacaagaagcctgaggatgccaccaccggagctcagatcgcc
gatttgtacaagaagcagcagcagattcagaatcaaggggagaaagctgacccggaggac
tactactga

DBGET integrated database retrieval system