KEGG   Pseudomonas rhizosphaerae: LT40_07460Help
Entry
LT40_07460        CDS       T03339                                 

Definition
(GenBank) bicarbonate ABC transporter permease
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
prh  Pseudomonas rhizosphaerae
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:prh00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    LT40_07460
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    LT40_07460
Transporters [BR:prh02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    LT40_07460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1628934..1629809)
Genome map
AA seq 291 aa AA seqDB search
MNAEVKKLHSAAQAVAKAQVKPPRMASLLKNTRRFVLQQCLPPVVIGALLLLVWQLVCSG
KGAALPPPTQVITDTWELIVDPFYDNGGNDKGMAWQLLASLSRVAYGYALAVVVGISLGV
LVGQSTWAMRGLDPLFQILRTVPPLAWLPLSLAGFKDSYPSAIFVIFITAIWPIIINTSV
GVRNIPEDYRNVAKVLRLNGLEYFSKIMLPAAAPYIFSGLRIGVGLSWLAIIAAEMLIGG
VGIGFFIWDAWNASRISDIILALAYVGVVGFCLDRLVAMVGRLVTRGTSQS
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgaagtgaagaagctgcacagcgccgcccaggcggtcgccaaggcgcaggtc
aagccgccgcggatggccagcctgctgaagaacacccgccgcttcgtgttgcaacagtgt
ttgccaccggtggtgattggcgccctgttgttgctggtctggcaactggtgtgcagcggc
aagggcgcggcgctgccgccgccgacccaggtcatcaccgacacctgggagctgatcgtc
gacccgttctacgacaacggcggcaacgacaagggcatggcctggcagttgctggccagc
ctgtcacgggtcgcctatggctacgccctggccgtggtggtggggatcagcctcggtgtg
ctggtggggcagtcgacctgggccatgcgcggcctcgatccgctgttccagatcctgcgt
acggtgccgccgctggcctggctgccgctgtcgctggccggcttcaaggacagctaccct
tcggcgatcttcgtgatcttcatcacggccatctggcccatcatcatcaacacctcggtg
ggcgtacgcaacattcccgaggactaccgcaacgtggccaaggtactgcggctcaacggc
ctggaatacttcagcaagatcatgctgccggcggccgcgccctacatcttctccggcctg
cgcatcggtgtcggcctgtcgtggctggcgatcatcgctgcggaaatgctgattggcggt
gtcggcatcgggttcttcatctgggacgcctggaacgcctcgcgcatcagcgacatcatc
ctcgccctggcctacgtaggggtggttggcttctgcctcgaccgtctcgtggcgatggtc
ggacgcttggtcacccgtggcacttcgcaaagctga

DBGET integrated database retrieval system