KEGG   Pseudomonas rhizosphaerae: LT40_16610Help
Entry
LT40_16610        CDS       T03339                                 

Definition
(GenBank) aldose epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
prh  Pseudomonas rhizosphaerae
Pathway
prh00010  Glycolysis / Gluconeogenesis
prh01100  Metabolic pathways
prh01110  Biosynthesis of secondary metabolites
prh01120  Microbial metabolism in diverse environments
prh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:prh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LT40_16610
Enzymes [BR:prh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     LT40_16610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AIS18920
UniProt: A0A089YZJ8
LinkDB All DBs
Position
complement(3693615..3694517)
Genome map
AA seq 300 aa AA seqDB search
MSEPQVESVKLDELNCWRISTDQAELLIAQQGAQVISYQRHGQQPLIWPNPAALYKPGKA
VRTGVPVCWPWFGNLARNPESVQAMRTATDEASAHGLVRTLDWELLGIDQLESGIKVELS
VPQAARGELPGWPHKVEVKLCVVLGDALEITLHSRNLDDHPVTLSQALHSYFAVSDVRQA
TVECLGGLTYIETLDNWQPRQQAGVLGFAGETDRIYLNTPAQLSFVDPGWHRRVTLASTG
SRSAVVWNPWTARAAALPDMADDGWQGMLCIETANVWDDVVTLAPGAACAMGVRFTASQL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagccgcaggtcgaatcggtcaagctcgatgaactcaattgctggcgcatcagc
accgatcaggccgagctgctgatcgcgcaacagggcgcccaggtaatcagctaccagcgc
cacgggcagcagccgctgatctggcccaacccggcggcgctgtacaagccgggcaaggcc
gttcgtaccggcgtgccggtgtgctggccgtggttcggcaacctggcgcgcaaccccgag
tcggtgcaggccatgcgtaccgccaccgacgaagcctctgcccatggcctggtgcgtacg
ctggactgggaattgctgggcatcgaccaactcgaatcgggcatcaaggtcgaactgagc
gtaccgcaggccgctcgcggcgaactgcctggatggccgcacaaggtcgaagtcaagctg
tgcgtggtactcggcgacgcgttggaaatcacactgcacagccgcaatctggacgaccat
ccggtcaccctgagccaggcgctgcacagttacttcgccgtcagtgacgtgcgccaggcc
acggtcgagtgcctgggcggcctgacctacatcgagaccctggacaactggcagccccgc
cagcaggccggggtgctcggctttgccggcgagaccgaccggatctacctgaacactccg
gcgcagctgagcttcgtcgacccgggctggcaccgtcgggtaaccctcgcctccaccggc
tcgcgcagcgcggtggtgtggaacccatggaccgcacgggccgcagccttgccggacatg
gccgacgacggttggcagggcatgctgtgcatcgagacggcgaacgtgtgggatgacgtg
gtgacgctggcgcctggcgcggcctgtgccatgggtgtgaggtttactgcttcacagctt
tga

DBGET integrated database retrieval system