KEGG   Propionibacterium sp. oral taxon 193: BCB70_09300Help
Entry
BCB70_09300       CDS       T04515                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
prl  Propionibacterium sp. oral taxon 193
Brite
Enzymes [BR:prl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BCB70_09300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_N Sod_Fe_C
Motif
Other DBs
NCBI-ProteinID: AOH46079
LinkDB All DBs
Position
complement(1965706..1966323)
Genome map
AA seq 205 aa AA seqDB search
MAVYTLPDLDYDYGALEPHISGKIMELHHDKHHNTYVQGANTALDKLAEAREKGDFSSIN
KLEKDLAFNLGGHINHSVFWKNMSPTGGDRPEGTDLAAAIDEFFGSFDGYKKQFEETAKG
VQGSGWGMLVWDVMGQRLNTMQLFDHQGNLPSTQIPVVQLDMWEHAYYLQYQNVKADYVT
AWWNVVNWADAEQRFTKARSITGLF
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggctgtttacacccttcccgatctcgactacgactacggcgcactggagccccacatc
tcgggcaagatcatggaactgcaccatgacaagcaccacaacacctacgtgcagggcgcc
aacactgccctggacaagctggccgaggcccgcgagaagggcgacttcagctccatcaac
aaactcgagaaggacttggcgttcaacctcggtgggcacatcaaccactccgtcttctgg
aagaacatgtcccccaccggcggtgaccgtcccgagggcactgatctcgccgccgccatc
gacgaattcttcggctccttcgacgggtacaagaagcagtttgaagagaccgccaaaggc
gttcagggctccggctggggcatgctcgtatgggatgtgatgggtcagcgcctcaacacc
atgcagctgttcgaccatcagggcaacctgccgtcaacccagatcccggtcgtccagctc
gacatgtgggagcacgcttactacctgcagtaccagaacgttaaggccgattacgtcacc
gcttggtggaacgtcgtcaactgggctgacgccgagcagcggttcaccaaggctcgttcc
atcacaggtctgttctga

DBGET integrated database retrieval system