KEGG   Prochlorococcus sp. MIT 0801: EW15_2094Help
Entry
EW15_2094         CDS       T03316                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
prm  Prochlorococcus sp. MIT 0801
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:prm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EW15_2094
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    EW15_2094
   00680 Methane metabolism
    EW15_2094
Enzymes [BR:prm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     EW15_2094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1712559..1715543)
Genome map
AA seq 994 aa AA seqDB search
MLKNPSNENISNHSTVCVEDQDPGSLLQQRLELVEDLWKTVLKSECPPDQTERLLRLKQL
SDPSKSNQDNSSQAIVQLITKMDLAEAISAARAFSLYFQLVNILEQRIEEDSYLESIEKG
KLDNSNSQIDPFAPALASQTAPATFTQLFERLRRLNVPPAQLDGLMREMDIRLVFTAHPT
EIVRHTVRHKQRRVATLLQQLQSNSLISESEKEIFRLQLEEEIRLWWRTDELHQFKPTVL
DEVDYALHYFQQVLFDAMPQLRRRLTTALASSYPDVEIPNEAFCTFGSWVGSDRDGNPSV
TPEITWRTACYQRQLMLDRYIASVQELRDQLSISMQWSQVSSPLLESLEMDRVRFPDVYE
ERAARYRLEPYRLKLSYTLERLRLTQLRNKQLADAGWQFSPDGKPLISTDNSFDEFLHYK
SVDELKNELELIRNSLVSTDLTCEPLDTLLNQVHIFGFSLASLDIRQESTRHSDALDELT
CYLDLPESYGAMSEESRVQWLMKELKTRRPLIPPAFEWSKSTQETISVFHMLHRLQKEFG
TRICRSYVISMSHTASDLLEVLLLAKESGLIDPTLGASDFLVVPLFETVEDLQHAPSVME
SLLQTDVYRELLPRVGEKKQPLQELMLGYSDSNKDSGFLSSNWEIHKAQIALQDLASRQG
IALRIFHGRGGSVGRGGGPAYQAILAQPSGTLQGRIKITEQGEVLASKYSLPELALYNLE
TVTTAVIQNSLVTNKLDATPSWNELMTRLAARSREHYRALVHDNPDLVQFFQVVTPIEEI
SKLQISSRPARRKSGAKDLSSLRAIPWVFGWTQSRFLLPSWFGVGTALATELKTDPDQME
MLRMLNQRWPFFRMLISKVEMTLSKVDLDVAHHYMVSLGGGDDRDAFAAIFDIISSEYTL
TKKLILEITDKSKLLSADPALQLSVNLRNRTIVPLGFLQVALLKRLRDQNRQPPISEDMS
SDSTQSSRTYSRSELLRGALLTINGIAAGMRNTG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaatccttctaacgaaaatatctctaatcactcgacagtatgtgttgaggat
caagatcctggatctttattgcaacaaaggcttgaactagttgaggatctatggaaaacc
gttctcaaaagtgaatgtccacctgatcaaaccgagagattattgcgattaaaacaatta
agtgaccctagcaagtcaaatcaagataattcctcacaggcaatagtccaattgattaca
aaaatggatttagctgaggcgatatctgctgctagggctttttctctttattttcagttg
gtaaatattctggagcaacgtatagaagaggatagttatttagaaagcatagaaaaaggg
aagctagacaatagtaattctcaaatagatccattcgctccagctttagctagtcagact
gctccagcaacttttacacaattatttgagagattacgtcgtttgaatgtgcctccagct
cagcttgatggtttgatgagggaaatggatattcgtcttgtttttacagctcatccaact
gaaatagttagacatactgtccgccataagcaacgaagggttgcaactcttttgcagcaa
cttcaatctaatagtttaatttccgaatcggagaaagaaatatttaggttgcaactagag
gaggagataaggctttggtggagaaccgatgagcttcatcaatttaaaccgactgttctt
gatgaggttgactatgcccttcattattttcagcaggttttgtttgatgccatgcctcaa
ttaagaaggagactgaccactgcacttgcttcaagttatccagacgtagagatccctaat
gaagctttttgtacgtttgggtcttgggtaggctcggatcgtgatgggaatccatctgtt
actcctgaaatcacatggagaacagcctgttaccaaagacaattaatgttggatagatac
attgcatcagtccaagagttaagagaccaactgagtatatctatgcaatggagtcaagta
agttctcctttgctagagtcattagaaatggatagagttcgtttccccgatgtctatgag
gaaagggctgctagatatcgactggaaccttatcgattgaagcttagctatacacttgag
agactacgacttactcagctacgtaataagcagctagcggatgctggatggcaattctca
cctgatggaaagcctttaatatctaccgataatagttttgatgaatttctccactacaaa
tctgtagatgaattaaagaatgaattagagcttattagaaatagtctagtaagtacagat
ctaacgtgtgaaccactagatactttgctaaatcaagttcatatctttggtttctctttg
gctagcttagatattaggcaagaaagcacacgacatagtgatgctttggatgagctcact
tgctatttagatctacctgagtcgtatggagcgatgagcgaggaaagtcgagttcaatgg
ttgatgaaagaattaaaaactcggagaccactgattcctcctgcttttgagtggtcaaaa
agtactcaagaaactatctcggtttttcatatgcttcataggcttcagaaagaatttggt
actcgtatatgtcgctcgtatgtaatttcgatgagtcatacggcatcagatttattagaa
gttcttcttttagccaaagagtccggtttgattgatccaactttaggagcttctgatttt
ctcgttgttccattatttgaaacggttgaggatttacaacatgctccctctgtaatggag
tcgttgctccagacagatgtttatcgtgaattacttccacgagtaggagagaaaaaacaa
ccgcttcaggaacttatgcttggatactctgatagtaataaggattctggttttctctca
agtaattgggaaattcataaggctcaaattgcactccaagacttagctagtagacaagga
atagcattacgtatttttcatggtagaggagggtctgtaggaagaggcggtggaccagct
tatcaagctattttggctcaacctagtggtacactccaaggacgtataaaaataacagag
caaggagaagttcttgcctcaaaatatagtcttccagaattagctttatataatcttgaa
actgtaactacagcagttattcaaaatagcttagttaccaataaattggatgctacacca
agttggaatgaattgatgaccagacttgcagctcgttcaagggagcattaccgagcttta
gttcacgacaatccagatttggttcaattttttcaagtagttactccaatagaagagatt
agtaagttgcaaatttctagtcgtcctgcccgacgaaagagtggtgcaaaagacttatca
agccttcgagctatcccatgggtctttggttggactcaaagtcgttttctcttgccaagt
tggtttggtgttggtacggctttagctactgaattaaagacagaccccgaccaaatggag
atgttgcgaatgttgaatcagagatggccattctttagaatgttgatctctaaagttgag
atgacactctcaaaagttgatttagatgttgcccatcattatatggttagtttaggtggc
ggtgatgatcgggatgctttcgctgcaattttcgatattatttcaagcgaatataccttg
actaagaaattaattttagaaattactgacaagtcaaaactattaagcgcagaccctgct
ttgcagttatctgtcaacctgagaaatcggactattgtacctttaggatttttacaagtt
gctcttcttaaacgcttaagagatcagaaccgtcaaccaccaattagtgaggatatgagt
agtgactctactcaaagttcacgtacatatagccgtagtgaattattgcgtggtgcattg
ttgactataaatggtattgctgcaggtatgagaaacacaggatga

DBGET integrated database retrieval system