KEGG   Polaribacter reichenbachii: BW723_03685Help
Entry
BW723_03685       CDS       T04692                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
prn  Polaribacter reichenbachii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:prn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BW723_03685
  Amino acid metabolism
   00310 Lysine degradation
    BW723_03685
   00380 Tryptophan metabolism
    BW723_03685
Enzymes [BR:prn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BW723_03685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(864406..867138)
Genome map
AA seq 910 aa AA seqDB search
MDKFSFLNAVHTGFIADLYDKYLVNPDSVEPSWRSFFQGYDLANENYSLTDEEEVVEIPQ
EVRKEFLVVDLINGYRTRGHLFTKTNPVRDRRQYQPTLDIENFGLSENDLDMEFSAGDIL
GLGKTSLSNIIKNLKRIYCDSIGVEYTYMRNPEKLKWWNDRLGQNDNHPNYSAEAKKYIL
GKLNQAVTFESFLQTKYVGQKRFSLEGGETLIPGIAVMLRDAAEVYGVKECVLGMAHRGR
LNTLVNIFKKPVRELFSEFEGKDFEDEDIDGDVKYHLGLTLSKTYRDGNEIKMNLVPNPS
HLETVAAVAEGITRAKIDRKYDGDSSKILPIIIHGDAAIAGQGIAYEVVQMAKLNGYKTG
GTVHIVVNNQIGFTTNYLDARSSTYCTDVGKVTLSPVLHVNADDTEAVCHAMEMALQFRM
RFEADVFIDLLGYRKYGHNEGDEPRFTQPKLYKAIAKHKNPKDIYAAQLIAEGSIDKNYL
TSITKEFKEMLSTEFDKSKEDTTSKVKEFMESTWEGFERQDKEAMLTTLDTTYSEENLKK
IAKVVSTVPDGANFVRKAERILQGRAKMAFETNELDWGMAENLAYGSLMEEGYNVRISGQ
DVERGTFSHRHAILRDEVSEERINLLNTNPNNKGKMTIYNSLLSEYGVLGFDYGYAMGNP
NTLTIWEAQFGDFSNGAQIMFDQYISAAEDKWKAQNGIVVLLPHGYEGQGSEHSSARIER
YLQLCAEDNMTVANCTTPANFYHLLRRQMKRNYRKPLIVFTPKSLLRHPKAVNTIQELAN
GEFQEVIDDTLNTDGVKKMVFCMGKFYYDLLAEREELQREDVALIRIEQLFPLHEEKIQK
IIDRYPNVTEYIWAQEEPRNMGAWSYMLQRFELKNLSVRSRKYYAVPAAGSSTRFKKRHR
AVIDSVFSND
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atggataaattttcgtttttaaacgcagtacataccggttttatagctgacttatatgat
aaatatttagttaatccagattcagtagaaccaagttggagaagtttttttcagggatat
gatttagcaaatgaaaattactcattaactgatgaagaagaagtcgtagaaattccgcaa
gaagttcgtaaagaatttttagtagtagatttaattaatgggtatagaacaagagggcat
ttgtttacaaaaacaaatcctgttagagatagaagacaataccaacctactttagatatc
gaaaattttggtttatccgaaaacgatttagacatggagttctctgcaggggatatactt
ggtttaggtaaaacatctttaagcaatattataaaaaatttaaaacgtatttattgcgat
tctattggtgtagaatatacctacatgcgtaatccagaaaaattaaaatggtggaatgat
cgtttgggtcaaaacgataatcatccaaattatagtgcagaagctaaaaaatatatttta
ggtaaattaaatcaagctgtaactttcgagagttttttacaaactaagtatgtgggtcaa
aaacgtttttctttagaaggaggagaaactttaataccaggtattgctgtaatgttaaga
gatgcagcagaagtttatggagttaaagaatgtgttttaggaatggcacacagaggtcgt
ttaaacacattagtaaatatctttaaaaaacctgtaagagaactttttagtgagtttgaa
ggtaaagattttgaagatgaagatatagatggagatgtaaaatatcatttaggtttaact
ttaagtaaaacttatagagatggtaatgaaattaaaatgaatttagtgccaaatccatcg
catttagaaacagtagcagctgtagcagaaggtattactagagcaaaaatcgatagaaaa
tacgatggtgattctagcaagatattaccaattattattcatggagatgctgcaattgca
ggtcaaggaattgcttatgaagtagttcagatggcaaaattaaatggttataaaacagga
ggtactgtacatattgttgtaaataatcaaattggttttacaacgaattatttagatgca
cgttctagtacgtattgtacagatgttggtaaagttactttatcgccagttttacacgtt
aatgcagacgatacagaagcagtttgtcatgctatggaaatggcgctgcaatttagaatg
cgatttgaagcagatgtttttatcgatttattaggatatcgtaaatatggtcataatgaa
ggtgatgagcctcgttttacacagccaaagttatacaaagcaattgcaaaacataaaaat
ccgaaagatatttatgcagcacaattaattgcagaaggtagtattgataaaaattactta
acatcaattactaaggaatttaaagaaatgttgagtacagaattcgataaatctaaagaa
gatactacttctaaggttaaagaatttatggaatctacttgggaaggctttgagcgacaa
gataaagaggccatgctaactactttagatactacttattctgaagaaaatttaaagaaa
attgcaaaagtagtttctacagtaccagatggagcaaattttgttagaaaagcagaaaga
attttgcaaggtagagcaaaaatggctttcgaaaccaatgaattagattggggaatggca
gaaaatttagcatatggttctttaatggaagaaggttataatgttagaatttctggacaa
gatgtagaaagaggtactttttctcatagacatgctattttacgcgatgaggtttctgaa
gaaagaataaacttattaaatacaaatcctaataataaaggtaaaatgacgatttataac
tcgttattatctgagtatggggttttaggtttcgattacggctatgcaatgggtaaccca
aatacattaacaatttgggaagcacagtttggagatttttctaacggtgctcaaattatg
ttcgatcaatatatttctgctgcagaagataaatggaaagctcaaaatggtattgttgtt
ttattacctcatggttatgaagggcaaggttctgagcattcatcagcaagaatagaacgt
tatttacaattatgtgcagaagataacatgacagttgcaaactgtacaacacctgcaaac
ttctatcacttattacgtcgtcaaatgaaacgtaattatagaaaacctttaattgtattc
acaccaaaaagtttattacgtcatccaaaagctgtaaatacaattcaagaattggcaaat
ggcgaattccaagaggttatagatgatactttaaatacagatggagttaagaaaatggtt
ttctgtatgggtaaattttattacgatttattagcagaaagagaagagttgcaaagagaa
gatgtagctttaattagaatagagcaattattccctttacacgaagaaaaaattcagaaa
ataatagacagatatccaaatgttacagaatatatttgggcacaagaagaacctagaaat
atgggggcttggagttatatgttacagcgttttgagttaaagaatttaagtgttcgctct
cgtaaatattatgcagtaccagctgcgggttctagtacacgttttaaaaagcgtcataga
gcagtaatagatagtgtttttagtaatgactaa

DBGET integrated database retrieval system