KEGG   Prevotella sp. oral taxon 299: HMPREF0669_01139Help
Entry
HMPREF0669_01139  CDS       T02809                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
pro  Prevotella sp. oral taxon 299
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pro00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HMPREF0669_01139
Enzymes [BR:pro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     HMPREF0669_01139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
unnamed:1657941..1658525
Genome map
AA seq 194 aa AA seqDB search
MVDFFISENHRPGRIEVICGSMFSGKTEELIRRLKRAKFAKQKVEIFKPSIDTRYSEEEV
VSHDKTSIKSTPVDASGSILLLSSDIEVVGIDEAQFFDESLVDVCNQLANKGVRVIIAGL
DMDFKGIPFGPMPALCAIADDVTKVHAICVKCGALAYVSHRLVENERRVLLGEQLEYEPL
CRECFQKSKKEHTP
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggtagatttttttataagtgaaaaccatcgtccaggtaggatagaggttatatgcgga
tcaatgttctcaggtaaaacagaagaacttattcgtagattaaaacgagcaaagtttgca
aaacagaaggttgaaatatttaagccatctattgatacacgttattctgaggaagaagtc
gtgagtcatgataagacaagtataaagagtacgcccgttgatgcttcgggttctatcctt
ttattatcatcagatatcgaggtcgtaggtattgatgaggcacaatttttcgatgaatcg
cttgtagatgtatgcaaccaattagccaacaaaggtgttcgtgtgattattgcaggattg
gatatggacttcaaagggattccttttggacctatgccagcactttgtgccattgcagac
gatgtaactaaggtacatgctatctgtgtgaaatgtggcgcattggcatatgttagtcac
cgacttgttgaaaatgagcgtcgtgtcctacttggagaacaactagaatatgaaccttta
tgtcgtgaatgctttcaaaaaagcaaaaaagaacatacaccataa

DBGET integrated database retrieval system