KEGG   Planococcus rifietoensis: AUC31_02515Help
Entry
AUC31_02515       CDS       T04201                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
prt  Planococcus rifietoensis
Brite
Enzymes [BR:prt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AUC31_02515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1254591..1255199
Genome map
AA seq 202 aa AA seqDB search
MAYELPELPYAYDALEPHIDKETMNIHHTKHHNTYVTNVNAALEGHDDLSSKSIEELVSD
LNAVPEDIRTAVRNNGGGHANHSLFWQLLSPNGGGQPTGAVADAINSKFGSFDEFKEKFE
AAGKTRFGSGWAWLVVSNGELEVTSTPNQDSPLSEGKTPILGVDVWEHAYYLKYQNRRPD
YLAAFWNVVNWDEVSKRYEAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcatacgaactaccggaactaccttacgcgtacgatgcgctagaaccgcacatcgac
aaagaaacaatgaacatccaccacacgaaacaccacaacacgtacgtaacaaacgtaaat
gcggccttggaaggtcatgacgatctttcttcaaaatcaatcgaagaattggtttctgac
ttgaacgcagtgccggaagatatccgcacagctgtccgcaacaacggcggcggccatgcg
aaccactcgctattctggcagcttctttccccgaacggcggcggacagccgactggcgcg
gtagctgacgcaatcaacagcaaattcggaagctttgacgagttcaaagaaaaattcgaa
gctgcgggcaaaacacgcttcggttctggctgggcttggctagtcgtttcgaacggcgaa
ctcgaagtcacgtcaacgccaaaccaggattctccactatctgaaggcaaaacgccgatc
cttggagtggacgtttgggagcacgcatactacttgaaataccagaaccgccgcccagac
tatttggcagcattctggaatgttgttaactgggacgaagtttctaagcgctacgaagct
gctaaataa

DBGET integrated database retrieval system